This software is free and open-source software. If you use it, please support the project by citing it in publications:
Gatto L, Lilley KS. MSnbase-an R/Bioconductor package for isobaric tagged mass spectrometry data visualization, processing and quantitation. Bioinformatics. 2012 Jan 15;28(2):288-9. doi: 10.1093/bioinformatics/btr645. PMID: 22113085.
MSnbase, efficient and elegant R-based processing and visualisation of raw mass spectrometry data. Laurent Gatto, Sebastian Gibb, Johannes Rainer. bioRxiv 2020.04.29.067868; doi: https://doi.org/10.1101/2020.04.29.067868
For bugs, typos, suggestions or other questions, please file an issue
in our tracking system (https://github.com/lgatto/MSnbase/issues) providing as
much information as possible, a reproducible example and the output of
sessionInfo().
If you don’t have a GitHub account or wish to reach a broader audience for general questions about proteomics analysis using R, you may want to use the Bioconductor support site: https://support.bioconductor.org/.
MSnbase (Gatto and Lilley 2012) aims are providing a reproducible research framework to proteomics data analysis. It should allow researcher to easily mine mass spectrometry data, explore the data and its statistical properties and visually display these.
MSnbase also aims at being compatible with the infrastructure implemented in Bioconductor, in particular Biobase. As such, classes developed specifically for proteomics mass spectrometry data are based on the eSet and ExpressionSet classes. The main goal is to assure seamless compatibility with existing meta data structure, accessor methods and normalisation techniques.
This vignette illustrates MSnbase utility using a dummy data sets provided with the package without describing the underlying data structures. More details can be found in the package, classes, method and function documentations. A description of the classes is provided in the MSnbase-development vignette1.
Raw mass spectrometry file are generally several hundreds of MB large
and most of this is used for binary raw spectrum data. As such, data
containers can easily grow very large and thus require large amounts of
RAM. This requirement is being tackled by avoiding to load the raw data
into memory and using on-disk random access to the content of
mzXML/mzML data files on demand. When focusing
on reporter ion quantitation, a direct solution for this is to trim the
spectra using the trimMz method to select the area of
interest and thus substantially reduce the size of the
Spectrum objects. This is illustrated in section
@ref(sec:trim).
Parallel processing The independent handling of
spectra is ideally suited for parallel processing. The
quantify method for example performs reporter peaks
quantitation in parallel.
Parallel support is provided by the BiocParallel
and various backends including multicore (forking, default on Linux),
simple networf network of workstations (SNOW, default on Windows) using
sockets, forking or MPI among others. We refer readers to the
documentation in BiocParallel.
Automatic parallel processing of spectra is only established for a
certain number of spectra (per file). This value (default is 1000) can
be set with the setMSnbaseParallelThresh function.
In sock-based parallel processing, the main worker process has to
start new R instances and connect to them via sock. Sometimes these
connections can not be established and the processes get stuck. To test
this, users can disable parallel processing by disabling parallel
processing with register(SerialParam()). To avoid these
deadlocks, it is possible to initiate the parallel processing setup
explicitly at the beginning of the script using, for example
library("doParallel")
registerDoParallel(3) ## using 3 slave nodes
register(DoparParam(), default = TRUE)
## rest of script comes belowOn-disk access Developmenets in version 2 of the package have solved the memory issue by implementing and on-disk version the of data class storing raw data (MSnExp, see section @ref(sec:msnexp)), where the spectra a accessed on-disk only when required. The benchmarking vignette compares the on-disk and in-memory implemenatations2. See details below.
MSnbase
is able to import raw MS data stored in one of the
XML-based formats as well as peak lists in the
mfg format3.
Raw data The XML-based formats,
mzXML (Pedrioli et al. 2004),
mzData (Orchard et al. 2007)
and mzML (Martens et al.
2010) can be imported with the readMSData function,
as illustrated below (see ?readMSData for more details). To
make use of the new on-disk implementation, set
mode = "onDisk" in readMSData rather than
using the default mode = "inMemory".
file <- dir(system.file(package = "MSnbase", dir = "extdata"),
full.names = TRUE, pattern = "mzXML$")
rawdata <- readMSData(file, msLevel. = 2, verbose = FALSE)Only spectra of a given MS level can be loaded at a time by setting
the msLevel parameter accordingly in
readMSData and in-memory data. In this document,
we will use the itraqdata data set, provided with MSnbase.
It includes feature metadata, accessible with the fData
accessor. The metadata includes identification data for the 55 MS2
spectra.
Version 2.0 and later of MSnbase
provide a new on-disk data storage model (see the
benchmarking vignette for more details). The new data backend
is compatible with the orignal in-memory model. To make use of
the new infrastructure, read your raw data by setting the
mode argument to "onDisk" (the default is
still "inMemory" but is likely to change in the future).
The new on-disk implementation supports several MS levels in a
single raw data object. All existing operations work irrespective of the
backend.
Peak lists can often be exported after spectrum
processing from vendor-specific software and are also used as input to
search engines. Peak lists in mgf format can be imported
with the function readMgfData (see
?readMgfData for details) to create experiment objects.
Experiments or individual spectra can be exported to an mgf
file with the writeMgfData methods (see
?writeMgfData for details and examples).
Experiments with multiple runs Although it is
possible to load and process multiple files serially and later merge the
resulting quantitation data as show in section @ref(sec:combine), it is
also feasible to load several raw data files at once. Here, we report
the analysis of an LC-MSMS experiment were 14 liquid chromatography (LC)
fractions were loaded in memory using readMSData on a
32-cores servers with 128 Gb of RAM. It took about 90 minutes to read
the 14 uncentroided mzXML raw files (4.9 Gb on disk in
total) and create a 3.3 Gb raw data object (an MSnExp instance,
see next section). Quantitation of 9 reporter ions (iTRAQ9
object, see @ref(sec:reporterions)) for 88690 features was performed in
parallel on 16 processors and took 76 minutes. The resulting
quantitation data was only 22.1 Mb and could easily be further
processed. These number are based on the older in-memory
implementation. As shown in the benchmarking vignette, using
on-disk data greatly reduces memory requirement and computation
time.
See also section @ref(sec:io2) to import quantitative data stored in
spreadsheets into R for further processing using MSnbase.
The MSnbase-iovignette[in R, open it with
vignette("MSnbase-io") or read it online here]
gives a general overview of MSnbase’s
input/ouput capabilites.
See section @ref(sec:io3) for importing chromatographic data of SRM/MRM experiments.
MSnbase supports also to write MSnExp or
OnDiskMSnExp objects to mzML or
mzXML files using the writeMSData function.
This is specifically useful in workflows in which the MS data was
heavily manipulated. Presently, each sample/file is exported into one
file.
Below we write the data in mzML format to a temporary
file. By setting the optional parameter copy = TRUE general
metadata (such as instrument info or all data processing descriptions)
are copied over from the originating file.
Raw data is contained in MSnExp objects, that stores all the spectra of an experiment, as defined by one or multiple raw data files.
## MSn experiment data ("MSnExp")
## Object size in memory: 1.9 Mb
## - - - Spectra data - - -
## MS level(s): 2
## Number of spectra: 55
## MSn retention times: 19:09 - 50:18 minutes
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011
## Updated from version 0.3.0 to 0.3.1 [Fri Jul 8 20:23:25 2016]
## MSnbase version: 1.1.22
## - - - Meta data - - -
## phenoData
## rowNames: 1
## varLabels: sampleNames sampleNumbers
## varMetadata: labelDescription
## Loaded from:
## dummyiTRAQ.mzXML
## protocolData: none
## featureData
## featureNames: X1 X10 ... X9 (55 total)
## fvarLabels: spectrum ProteinAccession ProteinDescription
## PeptideSequence
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## spectrum ProteinAccession ProteinDescription
## X1 1 BSA bovine serum albumin
## X10 10 ECA1422 glucose-1-phosphate cytidylyltransferase
## X11 11 ECA4030 50S ribosomal subunit protein L4
## X12 12 ECA3882 chaperone protein DnaK
## X13 13 ECA1364 succinyl-CoA synthetase alpha chain
## X14 14 ECA0871 NADP-dependent malic enzyme
## PeptideSequence
## X1 NYQEAK
## X10 VTLVDTGEHSMTGGR
## X11 SPIWR
## X12 TAIDDALK
## X13 SILINK
## X14 DFEVVNNESDPR
As illustrated above, showing the experiment textually displays it’s content:
Information about the raw data, i.e. the spectra.
Specific information about the experiment processing4 and
package version. This slot can be accessed with the
processingData method.
Other meta data, including experimental phenotype, file name(s)
used to import the data, protocol data, information about features
(individual spectra here) and experiment data. Most of these are
implemented as in the eSet class and are described in more
details in their respective manual pages. See ?MSnExp and
references therein for additional background information.
The experiment meta data associated with an MSnExp
experiment is of class MIAPE. It stores general information
about the experiment as well as MIAPE (Minimum Information About a
Proteomics Experiment) information Taylor et al.
(2008). This meta-data can be accessed with the
experimentData method. When available, a summary of
MIAPE-MS data can be printed with the msInfo method. See
?MIAPE for more details.
The raw data is composed of the 55 MS spectra. The spectra are named
individually (X1, X10, X11, X12, X13, X14, …) and stored in a
environment. They can be accessed individually with
itraqdata[["X1"]] or itraqdata[[1]], or as a
list with spectra(itraqdata). As we have loaded our
experiment specifying msLevel=2, the spectra will all be of
level 2 (or higher, if available).
## Object of class "Spectrum2"
## Precursor: 520.7833
## Retention time: 19:09
## Charge: 2
## MSn level: 2
## Peaks count: 1922
## Total ion count: 26413754
Attributes of individual spectra or of all spectra of an experiment
can be accessed with their respective methods:
precursorCharge for the precursor charge,
rtime for the retention time, mz for the MZ
values, intensity for the intensities, … see the
Spectrum, Spectrum1 and Spectrum2 manuals for
more details.
## [1] 1922
## X1 X10 X11 X12 X13 X14
## 1922 1376 1571 2397 2574 1829
## [1] 1149.31
## X1 X10 X11 X12 X13 X14
## 1149.31 1503.03 1663.61 1663.86 1664.08 1664.32
Reporter ions are defined with the ReporterIons class.
Specific peaks of interest are defined by a MZ value, a with around the
expected MZ and a name (and optionally a colour for plotting, see
section @ref(sec:plotting)). ReporterIons instances are
required to quantify reporter peaks in MSnExp experiments.
Instances for the most commonly used isobaric tags like iTRAQ 4-plex and
8-plex and TMT 6- and 10-plex tags are already defined in MSnbase.
See ?ReporterIons for details about how to generate new
ReporterIons objects.
## Object of class "ReporterIons"
## iTRAQ4: '4-plex iTRAQ' with 4 reporter ions
## - [iTRAQ4.114] 114.1112 +/- 0.05 (red)
## - [iTRAQ4.115] 115.1083 +/- 0.05 (green)
## - [iTRAQ4.116] 116.1116 +/- 0.05 (blue)
## - [iTRAQ4.117] 117.115 +/- 0.05 (yellow)
## Object of class "ReporterIons"
## TMT16HCD: '16-plex TMT HCD' with 16 reporter ions
## - [126] 126.1277 +/- 0.002 (#E55400)
## - [127N] 127.1248 +/- 0.002 (#E28100)
## - [127C] 127.1311 +/- 0.002 (#DFAC00)
## - [128N] 128.1281 +/- 0.002 (#DDD700)
## - [128C] 128.1344 +/- 0.002 (#B5DA00)
## - [129N] 129.1315 +/- 0.002 (#87D8000)
## - [129C] 129.1378 +/- 0.002 (#5BD500)
## - [130N] 130.1348 +/- 0.002 (#30D300)
## - [130C] 130.1411 +/- 0.002 (#05D000)
## - [131N] 131.1382 +/- 0.002 (#00CE23)
## - [131C] 131.1445 +/- 0.002 (#00CB4B)
## - [132N] 132.1415 +/- 0.002 (#00C972)
## - [132C] 132.1479 +/- 0.002 (#00C699)
## - [133N] 133.1449 +/- 0.002 (#00C4BE)
## - [133C] 133.1512 +/- 0.002 (#00A0C1)
## - [134N] 134.1482 +/- 0.002 (#0078BF)
Chromatographic data, i.e. intensity values along the retention time
dimension for a given \(m/z\)
range/slice, can be extracted with the chromatogram method.
Below we read a file from the msdata package and extract
the (MS level 1) chromatogram. Without providing an \(m/z\) and a retention time range the
function returns the total ion chromatogram (TIC) for each file within
the MSnExp or OnDiskMSnExp object. See also
section @ref(sec:io3) for importing chromatographic data from SRM/MRM
experiments.
f <- c(system.file("microtofq/MM14.mzML", package = "msdata"))
mtof <- readMSData(f, mode = "onDisk")
mtof_tic <- chromatogram(mtof)
mtof_tic## MChromatograms with 1 row and 1 column
## MM14.mzML
## <Chromatogram>
## [1,] length: 112
## phenoData with 1 variables
## featureData with 1 variables
Chromatographic data, represented by the intensity-retention time
duplets, is stored in the Chromatogram object. The
chromatogram method returns a Chromatograms
object (note the s) which holds multiple
Chromatogram objects and arranges them in a two-dimensional
grid with columns representing files/samples of the MSnExp
or OnDiskMSnExp object and rows \(m/z\)-retention time ranges. In the example
above the Chromatograms object contains only a single
Chromatogram object. Below we access this chromatogram
object. Similar to the Spectrum objects,
Chromatogram objects provide the accessor functions
intensity and rtime to access the data, as
well as the mz function, that returns the \(m/z\) range of the chromatogram.
## Object of class: Chromatogram
## Intensity values aggregated using: sum
## length of object: 112
## from file: 1
## mz range: [94.80679, 1004.962]
## rt range: [270.334, 307.678]
## MS level: 1
## F1.S001 F1.S002 F1.S003 F1.S004 F1.S005 F1.S006
## 64989 67445 77843 105097 155609 212760
## F1.S001 F1.S002 F1.S003 F1.S004 F1.S005 F1.S006
## 270.334 270.671 271.007 271.343 271.680 272.016
## [1] 94.80679 1004.96155
To extract the base peak chromatogram (the largest peak along the
\(m/z\) dimension for each retention
time/spectrum) we set the aggregationFun argument to
"max".
See the Chromatogram help page and the vignettes from
the xcms package
for more details and use cases, also on how to extract chromatograms for
specific ions.
The MSmap class can be used to isolate specific slices of
interest from a complete MS acquisition by specifying \(m/z\) and retention time ranges. One needs
a raw data file in a format supported by mzR’s
openMSfile (mzML, mzXML, …).
Below we first download a raw data file from the PRIDE repository and
create an MSmap containing all the MS1 spectra between acquired
between 30 and 35 minutes and peaks between 521 and 523 \(m/z\). See ?MSmap for
details.
## downloads the data
library("rpx")
px1 <- PXDataset("PXD000001")
mzf <- pxget(px1, 7)
## reads the data
ms <- openMSfile(mzf)
hd <- header(ms)
## a set of spectra of interest: MS1 spectra eluted
## between 30 and 35 minutes retention time
ms1 <- which(hd$msLevel == 1)
rtsel <- hd$retentionTime[ms1] / 60 > 30 &
hd$retentionTime[ms1] / 60 < 35
## the map
M <- MSmap(ms, ms1[rtsel], 521, 523, .005, hd, zeroIsNA = TRUE)## Object of class "MSmap"
## Map [75, 401]
## [1] Retention time: 30:01 - 34:58
## [2] M/Z: 521 - 523 (res 0.005)
The M map object can be rendered as a heatmap with
plot, as shown on figure @ref(fig:mapheat).
Heat map of a chunk of the MS data.
One can also render the data in 3 dimension with the
plot3D function, as show on figure @ref(fig:map3d).
3 dimensional represention of MS map data.
To produce figure @ref(fig:map3d2), we create a second MSmap
object containing the first two MS1 spectra of the first map (object
M above) and all intermediate MS2 spectra and display \(m/z\) values between 100 and 1000.
## Object of class "MSmap"
## Map [12, 901]
## [1] Retention time: 30:01 - 30:05
## [2] M/Z: 100 - 1000 (res 1)
3 dimensional represention of MS map data. MS1 and MS2 spectra are coloured in blue and magenta respectively.
Spectra can be plotted individually or as part of (subset)
experiments with the plot method. Full spectra can be
plotted (using full=TRUE), specific reporter ions of
interest (by specifying with reporters with
reporters=iTRAQ4 for instance) or both (see figure
@ref(fig:spectrumPlot)).
Raw MS2 spectrum with details about reporter ions.
It is also possible to plot all spectra of an experiment (figure
@ref(fig:msnexpPlot)). Lets start by subsetting the
itraqdata experiment using the protein accession numbers
included in the feature metadata, and keep the 6 from the BSA
protein.
## MSn experiment data ("MSnExp")
## Object size in memory: 0.11 Mb
## - - - Spectra data - - -
## MS level(s): 2
## Number of spectra: 3
## MSn retention times: 19:09 - 36:17 minutes
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011
## Updated from version 0.3.0 to 0.3.1 [Fri Jul 8 20:23:25 2016]
## Data [logically] subsetted 3 spectra: Mon May 4 21:14:06 2026
## MSnbase version: 1.1.22
## - - - Meta data - - -
## phenoData
## rowNames: 1
## varLabels: sampleNames sampleNumbers
## varMetadata: labelDescription
## Loaded from:
## dummyiTRAQ.mzXML
## protocolData: none
## featureData
## featureNames: X1 X52 X53
## fvarLabels: spectrum ProteinAccession ProteinDescription
## PeptideSequence
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## [1] "BSA" "BSA" "BSA"
These can then be visualised together by plotting the MSnExp object, as illustrated on figure @ref(fig:msnexpPlot).
Experiment-wide raw MS2 spectra. The y-axes of the individual spectra are automatically rescaled to the same range. See section @ref(sec:norm) to rescale peaks identically.
Customising your plots The MSnbase
plot methods have a logical plot parameter
(default is TRUE), that specifies if the plot should be
printed to the current device. A plot object is also (invisibly)
returned, so that it can be saved as a variable for later use or for
customisation.
MSnbase
uses the package to generate plots, which can subsequently easily be
customised. More details about can be found in (Wickham 2009) (especially chapter 8) and on http://had.co.nz/ggplot2/. Finally, if a plot object has
been saved in a variable p, it is possible to obtain a
summary of the object with summary(p). To view the data
frame used to generate the plot, use p$data.
Chromatographic data can be plotted using the plot
method which, in contrast to the plot method for
Spectrum classes, uses R base graphics. The
plot method is implemented for Chromatogram
and MChromatograms classes. The latter plots all
chromatograms for the same \(m/z\)-rt
range of all files in an experiment (i.e. for one row in the
MChromatograms object) into one plot.
Base peak chromatogram.
Typically, identification data is produced by a search engine and
serialised to disk in the mzIdentML (or mzid)
file format. This format can be parsed by openIDfile from
the mzR package
or mzID from the mzID
package. The MSnbase package relies on the former (which is
faster) and offers a simplified interface by converting the dedicated
identification data objects into data.frames.
library("MsDataHub")
idf <- MsDataHub::TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01.20141210.mzid()## see ?MsDataHub and browseVignettes('MsDataHub') for documentation
## downloading 1 resources
## retrieving 1 resource
## loading from cache
## 'data.frame': 5802 obs. of 35 variables:
## $ sequence : chr "RQCRTDFLNYLR" "ESVALADQVTCVDWRNRKATKK" "KELLCLAMQIIR" "QRMARTSDKQQSIRFLERLCGR" ...
## $ spectrumID : chr "controllerType=0 controllerNumber=1 scan=2949" "controllerType=0 controllerNumber=1 scan=6534" "controllerType=0 controllerNumber=1 scan=5674" "controllerType=0 controllerNumber=1 scan=4782" ...
## $ chargeState : int 3 2 2 3 3 3 2 3 3 2 ...
## $ rank : int 1 1 1 1 1 1 1 1 1 1 ...
## $ passThreshold : logi TRUE TRUE TRUE TRUE TRUE TRUE ...
## $ experimentalMassToCharge: num 548 1288 744 913 927 ...
## $ calculatedMassToCharge : num 548 1288 744 913 926 ...
## $ peptideRef : chr "Pep77" "Pep108" "Pep136" "Pep163" ...
## $ modNum : int 1 1 1 1 1 1 1 2 2 1 ...
## $ isDecoy : logi FALSE FALSE TRUE FALSE TRUE FALSE ...
## $ post : chr "V" "G" "Q" "D" ...
## $ pre : chr "R" "R" "R" "R" ...
## $ start : int 574 69 131 182 135 310 182 201 201 121 ...
## $ end : int 585 90 142 203 158 334 203 233 233 140 ...
## $ DatabaseAccess : chr "ECA2006" "ECA1676" "XXX_ECA2855" "ECA3009" ...
## $ DBseqLength : int 1295 110 157 437 501 477 437 1204 1204 210 ...
## $ DatabaseSeq : chr "" "" "" "" ...
## $ DatabaseDescription : chr "ECA2006 ATP-dependent helicase" "ECA1676 putative growth inhibitory protein" "" "ECA3009 putative coproporphyrinogen oxidase" ...
## $ scan.number.s. : num 2949 6534 5674 4782 5839 ...
## $ acquisitionNum : num 2949 6534 5674 4782 5839 ...
## $ spectrumFile : chr "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML" "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML" "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML" "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzML" ...
## $ idFile : chr "28bb5531d533_7857" "28bb5531d533_7857" "28bb5531d533_7857" "28bb5531d533_7857" ...
## $ MS.GF.RawScore : num 10 12 8 -5 8 7 21 -31 -31 -3 ...
## $ MS.GF.DeNovoScore : num 101 121 74 160 241 214 196 165 165 59 ...
## $ MS.GF.SpecEValue : num 4.62e-08 7.26e-08 9.34e-08 1.27e-07 1.32e-07 ...
## $ MS.GF.EValue : num 0.132 0.209 0.267 0.366 0.379 ...
## $ MS.GF.QValue : num 0.525 0.61 0.625 0.717 0.736 ...
## $ MS.GF.PepQValue : num 0.549 0.623 0.636 0.724 0.745 ...
## $ modPeptideRef : chr "Pep77" "Pep108" "Pep136" "Pep163" ...
## $ modName : chr "Carbamidomethyl" "Carbamidomethyl" "Carbamidomethyl" "Carbamidomethyl" ...
## $ modMass : num 57 57 57 57 57 ...
## $ modLocation : int 3 11 5 20 20 21 20 1 28 4 ...
## $ subOriginalResidue : chr NA NA NA NA ...
## $ subReplacementResidue : chr NA NA NA NA ...
## $ subLocation : int NA NA NA NA NA NA NA NA NA NA ...
The spectra along the rows are duplicated when the PSM can be assigned to multiple proteins, such as
## spectrumID sequence DatabaseAccess
## 3794 controllerType=0 controllerNumber=1 scan=5291 RKAYLLRMRR XXX_ECA2052
## 4886 controllerType=0 controllerNumber=1 scan=5291 ILLHPLRTLMR ECA1281
of when there are multiple modifications in a PSM, such as
## spectrumID
## 411 controllerType=0 controllerNumber=1 scan=4936
## 412 controllerType=0 controllerNumber=1 scan=4936
## sequence modName modLocation
## 411 ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK Carbamidomethyl 2
## 412 ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK Carbamidomethyl 23
At this stage, it is useful to perform some exploratory data analysis and visualisation on the identification data. For example
##
## FALSE TRUE
## 2906 2896
##
## 2 3 4 5 6
## 3312 2064 400 23 3
library("ggplot2")
ggplot(data = iddf, aes(x = MS.GF.RawScore, colour = isDecoy)) +
geom_density() +
facet_wrap(~chargeState)The filterIdentificationDataFrame function can be used
to remove - PSMs that match decoy entries - PSMs of rank > 1 - PSMs
that match non-proteotypic proteins
This data.frame can be now be further reduced so that
individual rows represent unique spectra, which can be done with the
reduce method.
This reduces the number of rows from 2710 to 2646.
The first duplicated spectrum mentioned above is now unique as is
matched a decoy protein that was filtered out with
filterIdentificationDataFrame.
## spectrumID sequence DatabaseAccess
## 1808 controllerType=0 controllerNumber=1 scan=5291 ILLHPLRTLMR ECA1281
The matches to multiple modification in the same peptide are now combined into a single row and documented as semicolon-separated values.
## spectrumID
## 1659 controllerType=0 controllerNumber=1 scan=4936
## sequence
## 1659 ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK;ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK
## modName modLocation
## 1659 Carbamidomethyl;Carbamidomethyl 2;23
This is the form that is used when combined to raw data, as described in the next section.
MSnbase
is able to integrate identification data from mzIdentML
(Jones et al. 2012) files.
We first load two example files shipped with the MSnbase
containing raw data (as above) and the corresponding identification
results respectively. The raw data is read with the
readMSData, as demonstrated above. As can be seen, the
default feature data only contain spectra numbers. More data about the
spectra is of course available in an MSnExp object, as
illustrated in the previous sections. See also ?pSet and
?MSnExp for more details.
## find path to a mzXML file
quantFile <- dir(system.file(package = "MSnbase", dir = "extdata"),
full.names = TRUE, pattern = "mzXML$")
## find path to a mzIdentML file
identFile <- dir(system.file(package = "MSnbase", dir = "extdata"),
full.names = TRUE, pattern = "dummyiTRAQ.mzid")
## create basic MSnExp
msexp <- readMSData(quantFile, verbose = FALSE)
head(fData(msexp), n = 2)## spectrum
## F1.S1 1
## F1.S2 2
The addIdentificationData method takes an
MSnExp instance (or an MSnSet instance storing
quantitation data, see section @ref(sec:quant)) as first argument and
one or multiple mzIdentML file names (as a character
vector) as second one5 and updates the MSnExp feature
data using the identification data read from the mzIdentML
file(s).
## spectrum acquisition.number sequence chargeState rank
## F1.S1 1 1 VESITARHGEVLQLRPK 3 1
## F1.S2 2 2 IDGQWVTHQWLKK 3 1
## passThreshold experimentalMassToCharge calculatedMassToCharge peptideRef
## F1.S1 TRUE 645.3741 645.0375 Pep2
## F1.S2 TRUE 546.9586 546.9633 Pep1
## modNum isDecoy post pre start end DatabaseAccess DBseqLength DatabaseSeq
## F1.S1 0 FALSE A R 170 186 ECA0984 231
## F1.S2 0 FALSE A K 50 62 ECA1028 275
## DatabaseDescription
## F1.S1 ECA0984 DNA mismatch repair protein
## F1.S2 ECA1028 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
## scan.number.s. idFile MS.GF.RawScore MS.GF.DeNovoScore
## F1.S1 1 dummyiTRAQ.mzid -39 77
## F1.S2 2 dummyiTRAQ.mzid -30 39
## MS.GF.SpecEValue MS.GF.EValue modPeptideRef modName modMass modLocation
## F1.S1 5.527468e-05 79.36958 <NA> <NA> NA NA
## F1.S2 9.399048e-06 13.46615 <NA> <NA> NA NA
## subOriginalResidue subReplacementResidue subLocation nprot npep.prot
## F1.S1 <NA> <NA> NA 1 1
## F1.S2 <NA> <NA> NA 1 1
## npsm.prot npsm.pep
## F1.S1 1 1
## F1.S2 1 1
Finally we can use idSummary to summarise the percentage
of identified features per quantitation/identification pairs.
## spectrumFile idFile coverage
## 1 dummyiTRAQ.mzXML dummyiTRAQ.mzid 0.6
When identification data is present, and hence peptide sequences, one
can annotation fragment peaks on the MS2 figure by passing the peptide
sequence to the plot method.
itraqdata2 <- pickPeaks(itraqdata, verbose=FALSE)
i <- 14
s <- as.character(fData(itraqdata2)[i, "PeptideSequence"])Annotated MS2 spectrum.
The fragment ions are calculated with the
calculateFragments, described in section
@ref(sec:calcfrag).
One can remove the features that have not been identified using
removeNoId. This function uses by default the
pepseq feature variable to search the presence of missing
data (NA values) and then filter these non-identified
spectra.
## [1] "VESITARHGEVLQLRPK" "IDGQWVTHQWLKK" NA
## [4] NA "LVILLFR"
## [1] "VESITARHGEVLQLRPK" "IDGQWVTHQWLKK" "LVILLFR"
## spectrumFile idFile coverage
## 1 dummyiTRAQ.mzXML dummyiTRAQ.mzid 1
Similarly, the removeMultipleAssignment method can be
used to filter out non-unique features, i.e. that have been assigned to
protein groups with more than one member. This function uses by default
the nprot feature variable.
Note that removeNoId and
removeMultipleAssignment methods can also be called on
MSnExp instances.
MSnbase
is able to calculate theoretical peptide fragments via
calculateFragments.
## Fixed modifications used: C=57.02146
## Variable modifications used: None
## mz ion type pos z seq peptide
## 1 44.04947 a1 a 1 1 A AC[+57.02146]EK
## 2 204.08012 a2 a 2 1 AC AC[+57.02146]EK
## 3 333.12271 a3 a 3 1 ACE AC[+57.02146]EK
## 4 72.04439 b1 b 1 1 A AC[+57.02146]EK
## 5 232.07504 b2 b 2 1 AC AC[+57.02146]EK
## 6 361.11763 b3 b 3 1 ACE AC[+57.02146]EK
## 7 89.07094 c1 c 1 1 A AC[+57.02146]EK
## 8 249.10158 c2 c 2 1 AC AC[+57.02146]EK
## 9 378.14417 c3 c 3 1 ACE AC[+57.02146]EK
## 10 173.09207 x1 x 1 1 K AC[+57.02146]EK
## 11 302.13466 x2 x 2 1 EK AC[+57.02146]EK
## 12 462.16531 x3 x 3 1 CEK AC[+57.02146]EK
## 13 147.11280 y1 y 1 1 K AC[+57.02146]EK
## 14 276.15539 y2 y 2 1 EK AC[+57.02146]EK
## 15 436.18604 y3 y 3 1 CEK AC[+57.02146]EK
## 16 130.08625 z1 z 1 1 K AC[+57.02146]EK
## 17 259.12884 z2 z 2 1 EK AC[+57.02146]EK
## 18 419.15949 z3 z 3 1 CEK AC[+57.02146]EK
## 19 284.12409 x2_ x_ 2 1 EK AC[+57.02146]EK
## 20 258.14483 y2_ y_ 2 1 EK AC[+57.02146]EK
## 21 241.11828 z2_ z_ 2 1 EK AC[+57.02146]EK
## 22 155.08150 x1_ x_ 1 1 K AC[+57.02146]EK
## 23 444.15474 x3_ x_ 3 1 CEK AC[+57.02146]EK
## 24 129.10224 y1_ y_ 1 1 K AC[+57.02146]EK
## 25 418.17548 y3_ y_ 3 1 CEK AC[+57.02146]EK
## 26 112.07569 z1_ z_ 1 1 K AC[+57.02146]EK
## 27 401.14893 z3_ z_ 3 1 CEK AC[+57.02146]EK
It is also possible to match these fragments against an Spectrum2 object.
## Fixed modifications used: C=57.02146
## Variable modifications used: None
## mz intensity ion type pos z seq error
## 1 100.0005 0.00 b1 b 1 1 V 0.07522824
## 2 429.2563 1972344.00 b4 b 4 1 VESI -0.02189010
## 3 512.3044 684918.00 b5_ b_ 5 1 VESIT -0.03290132
## 4 513.3047 2574137.00 y4 y 4 1 LRPK 0.04598246
## 5 583.3300 1440833.75 b6_ b_ 6 1 VESITA -0.02142609
## 6 754.4504 537234.81 y6 y 6 1 LQLRPK 0.04293155
## 7 836.6139 82364.42 y7* y* 7 1 VLQLRPK -0.07865960
## 8 982.5354 500159.06 y8 y 8 1 EVLQLRPK 0.06897061
## 9 1080.5867 209363.69 b10 b 10 1 VESITARHGE -0.04344392
## 10 1672.8380 76075.02 b15* b* 15 1 VESITARHGEVLQLR 0.07488430
## 11 1688.0375 136748.83 y15* y* 15 1 SITARHGEVLQLRPK -0.07729359
The current section is not executed dynamically for package size and processing time constrains. The figures and tables have been generated with the respective methods and included statically in the vignette for illustration purposes.
MSnbase allows easy and flexible access to the data, which allows to visualise data features to assess it’s quality. Some methods are readily available, although many QC approaches will be experiment specific and users are encourage to explore their data.
The plot2d method takes one MSnExp instance as
first argument to produce retention time vs. precursor MZ
scatter plots. Points represent individual MS2 spectra and can be
coloured based on precursor charge (with second argument
z="charge"), total ion count (z="ionCount"),
number of peaks in the MS2 spectra z="peaks.count") or,
when multiple data files were loaded, file z="file"), as
illustrated on the next figure. The lower
right panel is produced for only a subset of proteins. See the method
documentation for more details.
plot2d
output.The plotDensity method illustrates the distribution of
several parameters of interest (see figure
below). Similarly to plot2d, the first argument is an
MSnExp instance. The second is one of
precursor.mz, peaks.count or
ionCount, whose density will be plotted. An optional third
argument specifies whether the x axes should be logged.
plotDensity
output.The plotMzDelta method6 implements the \(m/z\) delta plot from (Foster et al. 2011) The \(m/z\) delta plot illustrates the
suitability of MS2 spectra for identification by plotting the \(m/z\) differences of the most intense
peaks. The resulting histogram should optimally shown outstanding bars
at amino acid residu masses. More details and parameters are described
in the method documentation (?plotMzDelta). The next figure has been generated using the
PRIDE experiment 12011, as in (Foster et al.
2011).
plotMzDelta
output for the PRIDE experiment 12011, as in figure 4A from (Foster et al. 2011).In section @ref(sec:incompdissoc), we illustrate how to assess incomplete reporter ion dissociation.
There are several methods implemented to perform basic raw data
processing and manipulation. Low intensity peaks can be set to 0 with
the removePeaks method from spectra or whole experiments.
The intensity threshold below which peaks are removed is defined by the
t parameter. t can be specified directly as a
numeric. The default value is the character "min", that
will remove all peaks equal to the lowest non null intensity in any
spectrum. We observe the effect of the removePeaks method
by comparing total ion count (i.e. the total intensity in a spectrum)
with the ionCount method before (object
itraqdata) and after (object experiment) for
spectrum X55. The respective spectra are shown on figure
@ref(fig:spectrum-clean-plot).
## [1] 555408.8
## [1] 499769.6
Same spectrum before (left) and after setting peaks <= 400 to 0.
Unlike the name might suggest, the removePeaks method
does not actually remove peaks from the spectrum; they are set to 0.
This can be checked using the peaksCount method, that
returns the number of peaks (including 0 intensity peaks) in a spectrum.
To effectively remove 0 intensity peaks from spectra, and reduce the
size of the data set, one can use the clean method. The
effect of the removePeaks and clean methods
are illustrated on figure @ref(fig:preprocPlot).
## [1] 1726
## [1] 1726
## [1] 440
This figure illustrated the effect or the removePeaks and
clean methods. The left-most spectrum displays two peaks,
of max height 3 and 7 respectively. The middle spectrum shows the result
of calling removePeaks with argument t=3,
which sets all data points of the first peak, whose maximum height is
smaller or equal to t to 0. The second peak is unaffected.
Calling clean after removePeaks effectively
deletes successive 0 intensities from the spectrum, as shown on the
right plot.
Another useful manipulation method is trimMz, that takes
as parameters and MSnExp (or a Spectrum) and a numeric
mzlim. MZ values smaller then min(mzlim) or
greater then max(mzmax) are discarded. This method is
particularly useful when one wants to concentrate on a specific MZ
range, as for reporter ions quantification, and generally results in
substantial reduction of data size. Compare the size of the full trimmed
experiment to the original 1.9 Mb.
## [1] 100.0002 977.6636
## [1] 102.0612 473.3372
## MSn experiment data ("MSnExp")
## Object size in memory: 1.18 Mb
## - - - Spectra data - - -
## MS level(s): 2
## Number of spectra: 55
## MSn retention times: 19:09 - 50:18 minutes
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011
## Updated from version 0.3.0 to 0.3.1 [Fri Jul 8 20:23:25 2016]
## Curves <= 400 set to '0': Mon May 4 21:14:14 2026
## Spectra cleaned: Mon May 4 21:14:15 2026
## MSnbase version: 1.1.22
## - - - Meta data - - -
## phenoData
## rowNames: 1
## varLabels: sampleNames sampleNumbers
## varMetadata: labelDescription
## Loaded from:
## dummyiTRAQ.mzXML
## protocolData: none
## featureData
## featureNames: X1 X10 ... X9 (55 total)
## fvarLabels: spectrum ProteinAccession ProteinDescription
## PeptideSequence
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
As can be seen above, all processing performed on the experiment is recorded and displayed as integral part of the experiment object.
MSnExp and Spectrum2 instances also support
standard MS data processing such as smoothing and peak picking, as
described in the smooth and pickPeak manual
pages. The methods that either single spectra of experiments, process
the spectrum/spectra, and return a updated, processed, object. The
implementations originate from the package (Gibb
and Strimmer 2012).
Quantitation is performed on fixed peaks in the spectra, that are
specified with an ReporterIons object. A specific peak is
defined by it’s expected mz value and is searched for
within mz \(\pm\)
width. If no data is found, NA is
returned.
## [1] 114.1112 115.1083 116.1116 117.1150
## [1] 0.05
The quantify method takes the following parameters: an
MSnExp experiment, a character describing the quantification
method, the reporters to be quantified and a
strict logical defining whether data points ranging outside
of mz \(\pm\)
width should be considered for quantitation. Additionally,
a progress bar can be displaying when setting the verbose
parameter to TRUE. Three quantification methods are
implemented, as illustrated on figure @ref(fig:quantitationPlot).
Quantitation using sum sums all the data points in the
peaks to produce, for this example, 7, whereas method max
only uses the peak’s maximum intensity, 3. Trapezoidation
calculates the area under the peak taking the full with into account
(using strict = FALSE gives 0.375) or only the width as
defined by the reporter (using strict = TRUE gives 0.1).
See ?quantify for more details.
## Warning in geom_point(aes(x = 114.1, y = 3), alpha = I(1/18), colour = "red", : All aesthetics have length 1, but the data has 7 rows.
## ℹ Please consider using `annotate()` or provide this layer with data containing
## a single row.
The different quantitation methods. See text for details.
The quantify method returns MSnSet objects,
that extend the well-known eSet class defined in the Biobase
package. MSnSet instances are very similar to
ExpressionSet objects, except for the experiment meta-data that
captures MIAPE specific information. The assay data is a matrix of
dimensions \(n
\times m\), where \(m\) is the
number of features/spectra originally in the MSnExp used as
parameter in quantify and \(m\) is the number of reporter ions, that
can be accessed with the exprs method. The meta data is
directly inherited from the MSnExp instance.
qnt <- quantify(experiment,
method = "trap",
reporters = iTRAQ4,
strict = FALSE,
verbose = FALSE)
qnt## MSnSet (storageMode: lockedEnvironment)
## assayData: 55 features, 4 samples
## element names: exprs
## protocolData: none
## phenoData
## sampleNames: iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## varLabels: mz reporters
## varMetadata: labelDescription
## featureData
## featureNames: X1 X10 ... X9 (55 total)
## fvarLabels: spectrum ProteinAccession ... collision.energy (15 total)
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation: No annotation
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011
## Updated from version 0.3.0 to 0.3.1 [Fri Jul 8 20:23:25 2016]
## Curves <= 400 set to '0': Mon May 4 21:14:14 2026
## Spectra cleaned: Mon May 4 21:14:15 2026
## iTRAQ4 quantification by trapezoidation: Mon May 4 21:14:17 2026
## MSnbase version: 1.1.22
## iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## X1 1347.6158 2247.3097 3927.6931 7661.1463
## X10 739.9861 799.3501 712.5983 940.6793
## X11 27638.3582 33394.0252 32104.2879 26628.7278
## X12 31892.8928 33634.6980 37674.7272 37227.7119
## X13 26143.7542 29677.4781 29089.0593 27902.5608
## X14 6448.0829 6234.1957 6902.8903 6437.2303
The next figure illustrates the quantitation
of the TMT 10-plex isobaric tags using the quantify method
and the TMT10 reporter instance. The data on the \(x\) axis has been quantified using
method = "max" and centroided data (as generated using
ProteoWizard’s msconvert with vendor libraries’ peak
picking); on the \(y\) axis, the
quantitation method was trapezoidation and
strict = TRUE (that’s important for TMT 10-plex) and the
profile data. We observe a very good correlation.
If no peak is detected for a reporter ion peak, the respective
quantitation value is set to NA. In our case, there is 1
such case in row 41. We will remove the offending line using the
filterNA method. The pNA argument defines the
percentage of accepted missing values per feature. As we do not expect
any missing peaks, we set it to be 0 (which is also the detault
value).
##
## FALSE TRUE
## 219 1
## [1] 0
The filtering criteria for filterNA can also be defined
as a pattern of columns that can have missing values and columns that
must not exhibit any. See ?filterNA for details and
examples.
The infrastructure around the MSnSet class allows flexible
filtering using the [ sub-setting operator. Below, we mimic
the behaviour of filterNA(, pNA = 0) by calculating the row
indices that should be removed, i.e. those that have at least one
NA value and explicitly remove these rows. This method
allows one to devise and easily apply any filtering strategy.
See also the plotNA method to obtain a graphical
overview of the completeness of a data set.
If quantitation data is already available as a spreadsheet, it can be
imported, along with additional optional feature and sample (pheno) meta
data, with the readMSnSet function. This function takes the
respective text-based spreadsheet (comma- or tab-separated) file names
as argument to create a valid MSnSet instance.
Note that the quantitation data of MSnSet objects can also
be exported to a text-based spreadsheet file using the
write.exps method.
MSnbase
also supports the mzTab format, a light-weight,
tab-delimited file format for proteomics data. mzTab files
can be read into R with readMzTabData to create and
MSnSet instance.
See the MSnbase-io vignette for a general overview of MSnbase’s input/ouput capabilites.
Data from SRM/MRM experiments can be imported from mzML
files using the readSRMData function. The mzML
files are expected to contain chromatographic data for the same
precursor and product m/z values. The function returns a
MChromatograms object that arranges the data in a
two-dimensional array, each column representing the data of one file
(sample) and each row the chromatographic data for the same polarity,
precursor and product m/z. In the example code below we load a single
SRM file using readSRMData.
## MChromatograms with 137 rows and 1 column
## 1
## <Chromatogram>
## [1,] length: 523
## [2,] length: 523
## ... ...
## [136,] length: 962
## [137,] length: 962
## phenoData with 1 variables
## featureData with 10 variables
The precursor and product m/z values can be extracted with the
precursorMz and productMz functions. These
functions always return a matrix, each row providing the lower and upper
m/z value of the isolation window (in most cases minimal and maximal m/z
will be identical).
## mzmin mzmax
## [1,] 115 115
## [2,] 115 115
## [3,] 117 117
## [4,] 117 117
## [5,] 133 133
## [6,] 133 133
## mzmin mzmax
## [1,] 26.996 26.996
## [2,] 70.996 70.996
## [3,] 72.996 72.996
## [4,] 98.996 98.996
## [5,] 114.996 114.996
## [6,] 70.996 70.996
Single peak adjustment In certain cases, peak intensities need to be adjusted as a result of peak interferance. For example, the \(+1\) peak of the phenylalanine (F, Phe) immonium ion (with \(m/z\) 120.03) inteferes with the 121.1 TMT reporter ion. Below, we calculate the relative intensity of the +1 peaks compared to the main peak using the Rdisop package.
## [1] 120.0813
## [1] 0.08339707
If desired, one can thus specifically quantify the F immonium ion in the MS2 spectrum, estimate the intensity of the +1 ion (0.0834% of the F peak) and substract this calculated value from the 121.1 TMT reporter intensity.
The above principle can also be generalised for a set of overlapping peaks, as described below.
Reporter ions purity correction Impurities in the
reporter reagents can also bias the results and can be corrected when
manufacturers provide correction coefficients. These generally come as
percentages of each reporter ion that have masses differing by -2, -1,
+1 and +2 Da from the nominal reporter ion mass due to isotopic
variants. The purityCorrect method applies such correction
to MSnSet instances. It also requires a square matrix as second
argument, impurities, that defines the relative percentage
of reporter in the quantified each peak. See ?purityCorrect
for more details.
impurities <- matrix(c(0.929, 0.059, 0.002, 0.000,
0.020, 0.923, 0.056, 0.001,
0.000, 0.030, 0.924, 0.045,
0.000, 0.001, 0.040, 0.923),
nrow = 4)
qnt.crct <- purityCorrect(qnt, impurities)
head(exprs(qnt))## iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## X1 1347.6158 2247.3097 3927.6931 7661.1463
## X10 739.9861 799.3501 712.5983 940.6793
## X11 27638.3582 33394.0252 32104.2879 26628.7278
## X12 31892.8928 33634.6980 37674.7272 37227.7119
## X13 26143.7542 29677.4781 29089.0593 27902.5608
## X14 6448.0829 6234.1957 6902.8903 6437.2303
## iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## X1 1304.7675 2168.1082 3784.2244 8133.9211
## X10 743.8159 806.5647 696.9024 988.0787
## X11 27547.6515 33592.3997 32319.1803 27413.1833
## X12 32127.1898 33408.8353 37806.0787 38658.7865
## X13 26187.3141 29788.6254 29105.2485 28936.6871
## X14 6533.1862 6184.1103 6945.2074 6666.5633
The makeImpuritiesMatrix can be used to create impurity
matrices. It opens a rudimentary spreadsheet that can be directly
edited.
A set of imputation methods are available in the impute
method: it takes an MSnSet instance as input, the name of the
imputation method to be applied (one of bpca, knn, QRILC, MLE, MLE2,
MinDet, MinProb, min, zero, mixed, nbavg, with, RF, none), possible
additional parameters and returns an updated for MSnSet without
any missing values. Below, we apply a deterministic minimum value
imputation on the naset example data:
##
## FALSE TRUE
## 10254 770
##
## 0 1 2 3 4 8 9 10
## 301 247 91 13 2 23 10 2
## - - - Processing information - - -
## Data imputation using min Mon May 4 21:14:18 2026
## MSnbase version: 1.15.6
##
## FALSE
## 11024
As described in more details in (Lazar et al. 2016), there are two types of mechanisms resulting in missing values in LC/MSMS experiments.
Missing values resulting from absence of detection of a feature, despite ions being present at detectable concentrations. For example in the case of ion suppression or as a result from the stochastic, data-dependent nature of the MS acquisition method. These missing value are expected to be randomly distributed in the data and are defined as missing at random (MAR) or missing completely at random (MCAR).
Biologically relevant missing values, resulting from the absence of the low abundance of ions (below the limit of detection of the instrument). These missing values are not expected to be randomly distributed in the data and are defined as missing not at random (MNAR).
MAR and MCAR values can be reasonably well tackled by many imputation methods. MNAR data, however, requires some knowledge about the underlying mechanism that generates the missing data, to be able to attempt data imputation. MNAR features should ideally be imputed with a left-censor (for example using a deterministic or probabilistic minimum value) method. Conversely, it is recommended to use hot deck methods (for example nearest neighbour, maximum likelihood, etc) when data are missing at random.
Mixed imputation method. Black cells represent presence of quantitation values and light grey corresponds to missing data. The two groups of interest are depicted in green and blue along the heatmap columns. Two classes of proteins are annotated on the left: yellow are proteins with randomly occurring missing values (if any) while proteins in brown are candidates for non-random missing value imputation.
It is anticipated that the identification of both classes of missing values will depend on various factors, such as feature intensities and experimental design. Below, we use perform mixed imputation, applying nearest neighbour imputation on the 654 features that are assumed to contain randomly distributed missing values (if any) (yellow on figure @ref(fig:miximp)) and a deterministic minimum value imputation on the 35 proteins that display a non-random pattern of missing values (brown on figure @ref(fig:miximp)).
## Imputing along margin 1 (features/rows).
## MSnSet (storageMode: lockedEnvironment)
## assayData: 689 features, 16 samples
## element names: exprs
## protocolData: none
## phenoData
## sampleNames: M1F1A M1F4A ... M2F11B (16 total)
## varLabels: nNA
## varMetadata: labelDescription
## featureData
## featureNames: AT1G09210 AT1G21750 ... AT4G39080 (689 total)
## fvarLabels: nNA randna
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation:
## - - - Processing information - - -
## Data imputation using mixed Mon May 4 21:14:18 2026
## MSnbase version: 1.15.6
Please read ?MsCoreUtils::impute_matix() for a
description of the different methods.
A MSnSet object is meant to be compatible with further
downstream packages for data normalisation and statistical analysis.
There is also a normalise (also available as
normalize) method for expression sets. The method takes and
instance of class MSnSet as first argument, and a character to
describe the method to be used:
quantiles: Applies quantile normalisation (Bolstad et al. 2003) as implemented in the
normalize.quantiles function of the preprocessCore
package.
quantiles.robust: Applies robust quantile
normalisation (Bolstad et al. 2003) as
implemented in the normalize.quantiles.robust function of
the preprocessCore
package.
vsn: Applies variance stabilisation normalization
(Huber et al. 2002) as implemented in the
vsn2 function of the vsn
package.
max: Each feature’s reporter intensity is divided by
the maximum of the reporter ions intensities.
sum: Each feature’s reporter intensity is divided by
the sum of the reporter ions intensities.
See ?normalise for more methods. A scale
method for MSnSet instances, that relies on the
base::scale function.
qnt.max <- normalise(qnt, "max")
qnt.sum <- normalise(qnt, "sum")
qnt.quant <- normalise(qnt, "quantiles")
qnt.qrob <- normalise(qnt, "quantiles.robust")
qnt.vsn <- normalise(qnt, "vsn")The effect of these are illustrated on figure @ref(fig:normPlot) and figure @ref(fig:cvPlot) reproduces figure 3 of (Karp et al. 2010) that described the application of vsn on iTRAQ reporter data.
Comparison of the normalisation MSnSet methods. Note that vsn also glog-transforms the intensities.
## Warning: `qplot()` was deprecated in ggplot2 3.4.0.
## This warning is displayed once per session.
## Call `lifecycle::last_lifecycle_warnings()` to see where this warning was
## generated.
CV versus signal intensity comparison for log2 and vsn transformed data. Lines indicate running CV medians.
Note that it is also possible to normalise individual spectra or
whole MSnExp experiments with the normalise method
using the max method. This will rescale all peaks between 0
and 1. To visualise the relative reporter peaks, one should this first
trim the spectra using method trimMz as illustrated in
section @ref(sec:rawprocessing), then normalise the MSnExp with
normalise using method="max" as illustrated
above and plot the data using plot (figure
@ref(fig:msnexpNormPlot)).
Experiment-wide normalised MS2 spectra. The y-axes of the individual spectra is now rescaled between 0 and 1 (highest peak), as opposed to figure @ref(fig:msnexpPlot).
Additional dedicated normalisation method are available for MS2
label-free quantitation, as described in section @ref(sec:lf) and in the
quantify documentation.
The above quantitation and normalisation has been performed on quantitative data obtained from individual spectra. However, the biological unit of interest is not the spectrum but the peptide or the protein. As such, it is important to be able to summarise features that belong to a same group, i.e. spectra from one peptide, peptides that originate from one protein, or directly combine all spectra that have been uniquely associated to one protein.
MSnbase
provides one function, combineFeatures, that allows to
aggregate features stored in an MSnSet using build-in or user
defined summary function and return a new MSnSet instance. The
three main arguments are described below. Additional details can be
found in the method documentation.
combineFeatures’s first argument, object,
is an instance of class MSnSet, as has been created in the
section @ref(sec:quant) for instance. The second argument,
groupBy, is a factor than has as many elements
as there are features in the MSnSet object
argument. The features corresponding to the groupBy levels
will be aggregated so that the resulting MSnSet output will
have length(levels(groupBy)) features. Here, we will
combine individual MS2 spectra based on the protein they originate from.
As shown below, this will result in 40 new aggregated features.
## gb
## BSA ECA0172 ECA0435 ECA0452 ECA0469 ECA0621 ECA0631 ECA0691 ECA0871 ECA0978
## 3 1 2 1 2 1 1 1 1 1
## ECA1032 ECA1093 ECA1104 ECA1294 ECA1362 ECA1363 ECA1364 ECA1422 ECA1443 ECA2186
## 1 1 1 1 1 1 1 1 1 1
## ECA2391 ECA2421 ECA2831 ECA3082 ECA3175 ECA3349 ECA3356 ECA3377 ECA3566 ECA3882
## 1 1 1 1 1 2 1 1 2 1
## ECA3929 ECA3969 ECA4013 ECA4026 ECA4030 ECA4037 ECA4512 ECA4513 ECA4514 ENO
## 1 1 1 2 1 1 1 1 6 3
## [1] 40
The third argument, method, defined how to combine the
features. Predefined functions are readily available and can be
specified as strings (method="mean",
method="median", method="sum",
method="weighted.mean" or
method="medianpolish" to compute respectively the mean,
media, sum, weighted mean or median polish of the features to be
aggregated). Alternatively, is is possible to supply user defined
functions with method=function(x) { ... }. We will use the
median here.
## MSnSet (storageMode: lockedEnvironment)
## assayData: 40 features, 4 samples
## element names: exprs
## protocolData: none
## phenoData
## sampleNames: iTRAQ4.114 iTRAQ4.115 iTRAQ4.116 iTRAQ4.117
## varLabels: mz reporters
## varMetadata: labelDescription
## featureData
## featureNames: BSA ECA0172 ... ENO (40 total)
## fvarLabels: spectrum ProteinAccession ... CV.iTRAQ4.117 (19 total)
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation:
## - - - Processing information - - -
## Data loaded: Wed May 11 18:54:39 2011
## Updated from version 0.3.0 to 0.3.1 [Fri Jul 8 20:23:25 2016]
## Curves <= 400 set to '0': Mon May 4 21:14:14 2026
## Spectra cleaned: Mon May 4 21:14:15 2026
## iTRAQ4 quantification by trapezoidation: Mon May 4 21:14:17 2026
## Subset [55,4][54,4] Mon May 4 21:14:17 2026
## Removed features with more than 0 NAs: Mon May 4 21:14:17 2026
## Dropped featureData's levels Mon May 4 21:14:17 2026
## Combined 54 features into 40 using median: Mon May 4 21:14:19 2026
## MSnbase version: 2.39.1
Of interest is also the iPQF spectra-to-protein
summarisation method, which integrates peptide spectra characteristics
and quantitative values for protein quantitation estimation. See
?iPQF and references therein for details.
Note that if samples are not multiplexed, label-free MS2 quantitation by spectral counting is possible using MSnbase. Once individual spectra have been assigned to peptides and proteins (see section @ref(sec:id)), it becomes straightforward to estimate protein quantities using the simple peptide counting method, as illustrated in section @ref(sec:feataggregation).
sc <- quantify(msexp, method = "count")
## lets modify out data for demonstration purposes
fData(sc)$DatabaseAccess[1] <- fData(sc)$DatabaseAccess[2]
fData(sc)$DatabaseAccess## [1] "ECA1028" "ECA1028" "ECA0510"
## dummyiTRAQ.mzXML
## ECA0510 1
## ECA1028 2
Such count data could then be further analyses using dedicated count methods (originally developed for high-throughput sequencing) and directly available for MSnSet instances in the msmsTests Bioconductor package.
The spectral abundance factor (SAF) and the normalised form (NSAF) (Paoletti et al. 2006) as well as the spectral index (SI) and other normalised variations (SI\(_{GI}\) and SI\(_N\)) (Griffin et al. 2010) are also available. Below, we illustrate how to apply the normalised SI\(_N\) to the experiment containing identification data produced in section @ref(sec:id).
The spectra that did not match any peptide have already been remove
with the removeNoId method. As can be seen in the following
code chunk, the first spectrum could not be matched to any single
protein. Non-identified spectra and those matching multiple proteins are
removed automatically prior to any label-free quantitation. Once can
also remove peptide that do not match uniquely to proteins (as defined
by the nprot feature variable column) with the
removeMultipleAssignment method.
## DatabaseAccess nprot
## F1.S1 ECA0984 1
## F1.S2 ECA1028 1
## F1.S5 ECA0510 1
Note that the label-free methods implicitely apply feature aggregation (section @ref(sec:feataggregation)) and normalise (section @ref(sec:norm)) the quantitation values based on the total sample intensity and or the protein lengths (see (Paoletti et al. 2006) and (Griffin et al. 2010) for details).
Let’s now proceed with the quantitation using the
quantify, as in section @ref(sec:quant), this time however
specifying the method of interest, SIn (the
reporters argument can of course be ignored here). The
required peptide-protein mapping and protein lengths are extracted
automatically from the feature meta-data using the default
accession and length feature variables.
## - - - Processing information - - -
## Data loaded: Mon May 4 21:14:13 2026
## Filtered 2 unidentified peptides out [Mon May 4 21:14:14 2026]
## Quantitation by total ion current [Mon May 4 21:14:20 2026]
## Combined 3 features into 3 using sum: Mon May 4 21:14:20 2026
## Quantification by SIn [Mon May 4 21:14:20 2026]
## MSnbase version: 2.39.1
## dummyiTRAQ.mzXML
## ECA0510 0.0006553518
## ECA0984 0.0035384487
## ECA1028 0.0002684726
Other label-free methods can be applied by specifiying the
appropriate method argument. See ?quantify for
more details.
MSnbase
provides functionality to compare spectra against each other. The first
notable function is plot. If two Spectrum2 objects
are provided plot will draw two plots: the upper and lower
panel contain respectively the first and second spectrum. Common peaks
are drawn in a slightly darker colour.
centroided <- pickPeaks(itraqdata, verbose = FALSE)
(k <- which(fData(centroided)[, "PeptideSequence"] == "TAGIQIVADDLTVTNPK"))## [1] 41 42
## X46 X47
## 2046.175 2045.169
Comparing two MS2 spectra.
Currently MSnbase
supports three different metrics to compare spectra against each other:
common to calculate the number of common peaks,
cor to calculate the Pearson correlation and
dotproduct to calculate the dot product. See
?compareSpectra to apply other arbitrary metrics.
## [1] 8
## [1] 0.1105021
## [1] 0.1185025
compareSpectra supports MSnExp objects as
well.
## X1 X10 X11 X12 X13
## X1 NA 0.07672973 0.38024702 0.51579989 0.46647324
## X10 0.07672973 NA 0.11050214 0.11162512 0.08611906
## X11 0.38024702 0.11050214 NA 0.47184437 0.47905818
## X12 0.51579989 0.11162512 0.47184437 NA 0.57909089
## X13 0.46647324 0.08611906 0.47905818 0.57909089 NA
## X14 0.09999703 0.01558385 0.12165400 0.12057251 0.11853321
## X15 0.03314059 0.00416184 0.01733228 0.04796236 0.03196115
## X16 0.39140514 0.06634870 0.42259036 0.45624614 0.45469020
## X17 0.37945538 0.07188420 0.52292845 0.44791250 0.43679447
## X18 0.55367861 0.10286983 0.56621755 0.66884285 0.64262061
Below, we illustrate how to compare a set of spectra using a hierarchical clustering.
Quantitation using isobaric reporter tags assumes complete dissociation between the reporter group (red on the figure below), balance group (blue) and peptide (the peptide reactive group is drawn in green). However, incomplete dissociation does occur and results in an isobaric tag (i.e reporter and balance groups) specific peaks.
MSnbase provides, among others, a ReporterIons object for iTRAQ 4-plex that includes the 145 peaks, called iTRAQ5. This can then be used to quantify the experiment as show in section @ref(sec:quant) to estimate incomplete dissociation for each spectrum.
## Object of class "ReporterIons"
## iTRAQ5: '4-plex iTRAQ and reporter + balance group' with 5 reporter ions
## - [iTRAQ5.114] 114.1112 +/- 0.05 (red)
## - [iTRAQ5.115] 115.1083 +/- 0.05 (green)
## - [iTRAQ5.116] 116.1116 +/- 0.05 (blue)
## - [iTRAQ5.117] 117.115 +/- 0.05 (yellow)
## - [iTRAQ5.145] 145.1 +/- 0.05 (grey)
incompdiss <- quantify(itraqdata,
method = "trap",
reporters = iTRAQ5,
strict = FALSE,
verbose = FALSE)
head(exprs(incompdiss))## iTRAQ5.114 iTRAQ5.115 iTRAQ5.116 iTRAQ5.117 iTRAQ5.145
## X1 1347.6158 2247.3097 3927.6931 7661.1463 2063.8947
## X10 739.9861 799.3501 712.5983 940.6793 467.3615
## X11 27638.3582 33394.0252 32104.2879 26628.7278 13543.4565
## X12 31892.8928 33634.6980 37674.7272 37227.7119 11839.2558
## X13 26143.7542 29677.4781 29089.0593 27902.5608 12206.5508
## X14 6448.0829 6234.1957 6902.8903 6437.2303 427.6654
Figure @ref(fig:incompdissPlot) compares these intensities for the whole experiment.
## `geom_smooth()` using formula = 'y ~ x'
Boxplot and scatterplot comparing intensities of the 4 reporter ions (or their sum, on the right) and the incomplete dissociation specific peak.
Combining mass spectrometry runs can be done in two different ways depending on the nature of these runs. If the runs represent repeated measures of identical samples, for instance multiple fractions, the data has to be combine along the row of the quantitation matrix: all the features (along the rows) represent measurements of the same set of samples (along the columns). In this situation, described in section @ref(sec:comb1), two experiments of dimensions \(n_1\) (rows) by \(m\) (columns and \(n_2\) by \(m\) will produce a new experiment of dimensions \(n_1 + n_2\) by \(m\).
When however, different sets of samples have been analysed in
different mass spectrometry runs, the data has to be combined along the
columns of the quantitation matrix: some features will be shared across
experiments and should thus be aligned on a same row in the new data
set, whereas unique features to one experiment should be set as missing
in the other one. In this situation, described in section
@ref(sec:comb2), two experiments of dimensions \(n_1\) by \(m_1\) and \(n_2\) by \(m_2\) will produce a new experiment of
dimensions \(unique_{n_1} + unique_{n_2} +
shared_{n_1, n_2}\) by \(m_1 +
m_2\). The two first terms of the first dimension will be
complemented by NA values.
Default MSnSet feature names (X1,
X2, …) and sample names (iTRAQ4.114,
iTRAQ4.115, iTRAQ4.116, …) are not
informative. The features and samples of these anonymous quantitative
data-sets should be updated before being combined, to guide how to
meaningfully merge them.
To simulate this situation, let us use quantiation data from the
itraqdata object that is provided with the package as
experiment 1 and the data from the rawdata MSnExp
instance created at the very beginning of this document. Both
experiments share the same default iTRAQ 4-plex reporter names
as default sample names, and will thus automatically be combined along
rows.
## [1] "iTRAQ4.114" "iTRAQ4.115" "iTRAQ4.116" "iTRAQ4.117"
centroided(rawdata) <- FALSE
exp2 <- quantify(rawdata, reporters = iTRAQ4,
verbose = FALSE)
sampleNames(exp2)## [1] "iTRAQ4.114" "iTRAQ4.115" "iTRAQ4.116" "iTRAQ4.117"
It important to note that the features of these independent
experiments share the same default anonymous names: X1, X2, X3, …, that
however represent quantitation of distinct physical analytes. If the
experiments were to be combined as is, it would result in an error
because data points for the same feature name (say
X1) and the same sample name (say
iTRAQ4.114) have different values. We thus first update the
feature names to explicitate that they originate from different
experiment and represent quantitation from different spectra using the
convenience function updateFeatureNames. Note that updating
the names of one experiment would suffice here.
## [1] "X1" "X10" "X11" "X12" "X13" "X14"
## [1] "X1.exp1" "X10.exp1" "X11.exp1" "X12.exp1" "X13.exp1" "X14.exp1"
## [1] "F1.S1" "F1.S2" "F1.S3" "F1.S4" "F1.S5"
## [1] "F1.S1.exp2" "F1.S2.exp2" "F1.S3.exp2" "F1.S4.exp2" "F1.S5.exp2"
The two experiments now share the same sample names and have different feature names and will be combined along the row. Note that all meta-data is correctly combined along the quantitation values.
## Warning in combine(experimentData(x), experimentData(y)):
## unknown or conflicting information in MIAPE field 'email'; using information from first object 'x'
## [1] 55 4
## [1] 5 4
## [1] 60 4
Lets now create two MSnSets from the same raw data to
simulate two different independent experiments that share some features.
As done previously (see section @ref(sec:feataggregation)), we combine
the spectra based on the proteins they have been identified to belong
to. Features can thus naturally be named using protein accession
numbers. Alternatively, if peptide sequences would have been used as
grouping factor in combineFeatures, then these would be
good feature name candidates.
set.seed(1)
i <- sample(length(itraqdata), 35)
j <- sample(length(itraqdata), 35)
exp1 <- quantify(itraqdata[i], reporters = iTRAQ4,
verbose = FALSE)
exp2 <- quantify(itraqdata[j], reporters = iTRAQ4,
verbose = FALSE)
exp1 <- droplevels(exp1)
exp2 <- droplevels(exp2)
table(featureNames(exp1) %in% featureNames(exp2))##
## FALSE TRUE
## 14 21
exp1 <- combineFeatures(exp1,
groupBy = fData(exp1)$ProteinAccession)
exp2 <- combineFeatures(exp2,
groupBy = fData(exp2)$ProteinAccession)## Your data contains missing values. Please read the relevant section in
## the combineFeatures manual page for details on the effects of missing
## values on data aggregation.
## [1] "BSA" "ECA0172" "ECA0469" "ECA0631" "ECA0691" "ECA0871"
## [1] "BSA" "ECA0435" "ECA0469" "ECA0621" "ECA0871" "ECA1032"
The droplevels drops the unused featureData
levels. This is required to avoid passing absent levels as
groupBy in combineFeatures. Alternatively, one
could also use factor(fData(exp1)\$ProteinAccession) as
groupBy argument.
The feature names are updated automatically by
combineFeatures, using the groupBy argument.
Proper feature names, reflecting the nature of the features (spectra,
peptides or proteins) is critical when multiple experiments are to be
combined, as this is done using common features as defined by their
names (see below).
Sample names should also be updated to replace anonymous reporter
names with relevant identifiers; the individual reporter data is stored
in the phenoData and is not lost. A convenience function
updateSampleNames is provided to append the
MSnSet’s variable name to the already defined names, although
in general, biologically relevant identifiers are preferred.
## [1] "iTRAQ4.114" "iTRAQ4.115" "iTRAQ4.116" "iTRAQ4.117"
## [1] "iTRAQ4.114.exp1" "iTRAQ4.115.exp1" "iTRAQ4.116.exp1" "iTRAQ4.117.exp1"
sampleNames(exp1) <- c("Ctrl1", "Cond1", "Ctrl2", "Cond2")
sampleNames(exp2) <- c("Ctrl3", "Cond3", "Ctrl4", "Cond4")At this stage, it is not yet possible to combine the two experiments, because their feature data is not compatible yet; they share the same feature variable labels, i.e. the feature data column names (spectrum, ProteinAccession, ProteinDescription, …), but the part of the content is different because the original data was (in particular all the spectrum centric data: identical peptides in different runs will have different retention times, precursor intensities, …). Feature data with identical labels (columns in the data frame) and names (row in the data frame) are expected to have the same data and produce an error if not conform.
## spectrum ProteinAccession ProteinDescription PeptideSequence
## BSA 1 BSA bovine serum albumin NYQEAK
## spectrum ProteinAccession ProteinDescription PeptideSequence
## BSA 1 BSA bovine serum albumin NYQEAK
Instead of removing these identical feature data columns, one can use
a second convenience function, updateFvarLabels, to update
feature labels based on the experiements variable name and maintain all
the metadata.
## [1] "spectrum.exp1" "ProteinAccession.exp1"
## [3] "ProteinDescription.exp1" "PeptideSequence.exp1"
## [5] "fileIdx.exp1" "retention.time.exp1"
## [1] "spectrum.exp2" "ProteinAccession.exp2"
## [3] "ProteinDescription.exp2" "PeptideSequence.exp2"
## [5] "fileIdx.exp2" "retention.time.exp2"
It is now possible to combine exp1 and
exp2, including all the meta-data, with the
combine method. The new experiment will contain the union
of the feature names of the individual experiments with missing values
inserted appropriately.
## [1] 36 8
## mz reporters
## Ctrl1 114.1112 iTRAQ4
## Cond1 115.1083 iTRAQ4
## Ctrl2 116.1116 iTRAQ4
## Cond2 117.1150 iTRAQ4
## Ctrl3 114.1112 iTRAQ4
## Cond3 115.1083 iTRAQ4
## Ctrl4 116.1116 iTRAQ4
## Cond4 117.1150 iTRAQ4
## Ctrl1 Cond1 Ctrl2 Cond2 Ctrl3 Cond3 Ctrl4
## ECA4513 10154.953 10486.943 11018.191 11289.552 NA NA NA
## ECA4514 6516.397 6746.337 6658.973 6838.491 12457.173 12695.491 14423.640
## ENO 77239.040 49352.793 22493.050 11187.588 39965.733 24967.397 NA
## ECA0435 NA NA NA NA 4923.628 5557.818 5775.203
## Cond4
## ECA4513 NA
## ECA4514 14556.855
## ENO 5925.663
## ECA0435 5079.295
## MSnSet (storageMode: lockedEnvironment)
## assayData: 36 features, 8 samples
## element names: exprs
## protocolData: none
## phenoData
## sampleNames: Ctrl1 Cond1 ... Cond4 (8 total)
## varLabels: mz reporters
## varMetadata: labelDescription
## featureData
## featureNames: BSA ECA0172 ... ECA4037 (36 total)
## fvarLabels: spectrum.exp1 ProteinAccession.exp1 ...
## CV.iTRAQ4.117.exp2 (38 total)
## fvarMetadata: labelDescription
## experimentData: use 'experimentData(object)'
## Annotation:
## - - - Processing information - - -
## Combined [27,4] and [24,4] MSnSets Mon May 4 21:14:26 2026
## MSnbase version: 2.39.1
In summary, when experiments with different samples need to be
combined (along the columns), one needs to (1) clarify the sample names
using updateSampleNames or better manually, for biological
relevance and (2) update the feature data variable labels with
updateFvarLabels. The individual experiments (there can be
more than 2) can then easily be combined with the combine
method while retaining the meta-data.
If runs for the same sample (different fractions for example) need to
be combines, one needs to (1) differentiate the feature provenance with
updateFeatureNames prior to use combine.
A single MSnSet can also be split along the features/rows or
samples/columns using the split method and a factor
defining the splitting groups, resulting in an instance of class
MSnSetList:
## membrane.prep fraction replicate
## M1F1A 1 1 A
## M1F4A 1 4 A
## M1F7A 1 7 A
## M1F11A 1 11 A
## M1F2B 1 2 B
## M1F5B 1 5 B
## Instance of class 'MSnSetList' containig 2 objects.
Above, we split along the columns/samples, but the function would equally work with a factor of length equal to the number of rows of the MSnSet (or a feature variable name) to split along the rows/features.
Finally, the effect of split can be reverted by
unsplit.
## [1] TRUE
See ?MSnSetList for more details about the class,
split and unsplit and comments about storing
multiple assays pertaining the same experiment.
It is sometimes useful to average a set of replicated experiments to
facilitate their visualisation. This can be easily achieved with the
averageMSnSet function, which takes a list of valid
MSnSet instances as input and creates a new object whose
expression values are an average of the original values. A value of
dispersion (disp) and a count of missing values
(nNA) is recorded in the feature metadata slot. The average
and dispersion are computed by default as the median and
(non-parametric) coefficient of variation (see ?npcv for
details), although this can easily be parametrised, as described in
?averageMSnSet.
The next code chunk illustrates the averaging function using three replicated experiments from (Tan et al. 2009) available in the pRolocdata package.
library("pRolocdata")
data(tan2009r1)
data(tan2009r2)
data(tan2009r3)
msnl <- MSnSetList(list(tan2009r1, tan2009r2, tan2009r3))
avgtan <- averageMSnSet(msnl)
head(exprs(avgtan))## X114 X115 X116 X117
## P20353 0.3605000 0.3035000 0.2095000 0.1265000
## P53501 0.4299090 0.1779700 0.2068280 0.1852625
## Q7KU78 0.1704443 0.1234443 0.1772223 0.5290000
## P04412 0.2567500 0.2210000 0.3015000 0.2205000
## Q7KJ73 0.2160000 0.1830000 0.3420000 0.2590000
## Q7JZN0 0.0965000 0.2509443 0.4771667 0.1750557
## X114 X115 X116 X117
## P20353 0.076083495 0.1099127 0.109691169 0.14650198
## P53501 0.034172542 0.2640556 0.005139653 0.17104568
## Q7KU78 0.023198743 0.4483795 0.027883087 0.04764499
## P04412 0.053414021 0.2146751 0.090972139 0.27903810
## Q7KJ73 0.000000000 0.0000000 0.000000000 0.00000000
## Q7JZN0 0.007681865 0.1959534 0.097873350 0.06210542
## X114 X115 X116 X117
## P20353 1 1 1 1
## P53501 1 1 1 1
## Q7KU78 0 0 0 0
## P04412 1 1 1 1
## Q7KJ73 2 2 2 2
## Q7JZN0 0 0 0 0
We are going to visualise the average data on a principle component
(PCA) plot using the plot2D function from the pRoloc
package (Gatto et al. 2014). In addition,
we are going to use the measure of dispersion to highlight averages with
high variability by taking, for each protein, the maximum observed
dispersion in the 4 samples. Note that in the default implementation,
dispersions estimated from a single measurement (i.e. that had 2 missing
values in our example) are set to 0; we will set these to the overal
maximum observed dispersion.
## [1] 0.01152877 1.20888923
PCA plot of the averaged MSnSet. The point sizes are proportional to the dispersion of the protein quantitation across the averaged data.
MSnbase
can also be used for MSE data independent acquisition from
Waters instrument. The MSE pipeline depends on the
Bioconductor synapter
package (Bond et al. 2013) that produces
MSnSet instances for indvidual acquisitions. The MSnbase
infrastructure can subsequently be used to further combine experiments,
as shown in section @ref(sec:comb2) and apply top3 quantitation
using the topN method.
## R version 4.6.0 (2026-04-24)
## Platform: x86_64-pc-linux-gnu
## Running under: Ubuntu 24.04.4 LTS
##
## Matrix products: default
## BLAS: /usr/lib/x86_64-linux-gnu/openblas-pthread/libblas.so.3
## LAPACK: /usr/lib/x86_64-linux-gnu/openblas-pthread/libopenblasp-r0.3.26.so; LAPACK version 3.12.0
##
## locale:
## [1] LC_CTYPE=en_US.UTF-8 LC_NUMERIC=C
## [3] LC_TIME=en_US.UTF-8 LC_COLLATE=en_US.UTF-8
## [5] LC_MONETARY=en_US.UTF-8 LC_MESSAGES=en_US.UTF-8
## [7] LC_PAPER=en_US.UTF-8 LC_NAME=C
## [9] LC_ADDRESS=C LC_TELEPHONE=C
## [11] LC_MEASUREMENT=en_US.UTF-8 LC_IDENTIFICATION=C
##
## time zone: Etc/UTC
## tzcode source: system (glibc)
##
## attached base packages:
## [1] grid stats4 stats graphics grDevices utils datasets
## [8] methods base
##
## other attached packages:
## [1] gplots_3.3.0 MsDataHub_1.13.0 msdata_0.53.0
## [4] pRoloc_1.53.0 BiocParallel_1.47.0 MLInterfaces_1.93.0
## [7] cluster_2.1.8.2 annotate_1.91.0 XML_3.99-0.23
## [10] AnnotationDbi_1.75.0 IRanges_2.47.0 pRolocdata_1.49.0
## [13] Rdisop_1.73.0 zoo_1.8-15 MSnbase_2.39.1
## [16] ProtGenerics_1.45.0 S4Vectors_0.51.1 mzR_2.47.0
## [19] Rcpp_1.1.1-1.1 Biobase_2.73.1 BiocGenerics_0.59.0
## [22] generics_0.1.4 ggplot2_4.0.3 BiocStyle_2.41.0
##
## loaded via a namespace (and not attached):
## [1] splines_4.6.0 bitops_1.0-9
## [3] filelock_1.0.3 tibble_3.3.1
## [5] hardhat_1.4.3 preprocessCore_1.75.0
## [7] pROC_1.19.0.1 rpart_4.1.27
## [9] lifecycle_1.0.5 httr2_1.2.2
## [11] doParallel_1.0.17 globals_0.19.1
## [13] lattice_0.22-9 MASS_7.3-65
## [15] MultiAssayExperiment_1.39.0 dendextend_1.19.1
## [17] magrittr_2.0.5 limma_3.69.0
## [19] plotly_4.12.0 sass_0.4.10
## [21] rmarkdown_2.31 jquerylib_0.1.4
## [23] yaml_2.3.12 otel_0.2.0
## [25] MsCoreUtils_1.25.3 DBI_1.3.0
## [27] buildtools_1.0.0 RColorBrewer_1.1-3
## [29] lubridate_1.9.5 abind_1.4-8
## [31] GenomicRanges_1.65.0 purrr_1.2.2
## [33] mixtools_2.0.0.1 AnnotationFilter_1.37.0
## [35] nnet_7.3-20 rappdirs_0.3.4
## [37] ipred_0.9-15 lava_1.9.0
## [39] listenv_0.10.1 maketools_1.3.2
## [41] parallelly_1.47.0 ncdf4_1.24
## [43] codetools_0.2-20 DelayedArray_0.39.1
## [45] tidyselect_1.2.1 Spectra_1.23.0
## [47] farver_2.1.2 viridis_0.6.5
## [49] matrixStats_1.5.0 BiocFileCache_3.3.0
## [51] Seqinfo_1.3.0 jsonlite_2.0.0
## [53] caret_7.0-1 e1071_1.7-17
## [55] PTMods_1.1.0 survival_3.8-6
## [57] iterators_1.0.14 foreach_1.5.2
## [59] segmented_2.2-1 tools_4.6.0
## [61] progress_1.2.3 glue_1.8.1
## [63] prodlim_2026.03.11 gridExtra_2.3
## [65] SparseArray_1.13.2 mgcv_1.9-4
## [67] xfun_0.57 MatrixGenerics_1.25.0
## [69] dplyr_1.2.1 withr_3.0.2
## [71] BiocManager_1.30.27 fastmap_1.2.0
## [73] caTools_1.18.3 digest_0.6.39
## [75] timechange_0.4.0 R6_2.6.1
## [77] colorspace_2.1-2 gtools_3.9.5
## [79] lpSolve_5.6.23 biomaRt_2.69.0
## [81] RSQLite_2.4.6 tidyr_1.3.2
## [83] hexbin_1.28.5 data.table_1.18.2.1
## [85] recipes_1.3.2 FNN_1.1.4.1
## [87] class_7.3-23 prettyunits_1.2.0
## [89] PSMatch_1.17.0 httr_1.4.8
## [91] htmlwidgets_1.6.4 S4Arrays_1.13.0
## [93] ModelMetrics_1.2.2.2 pkgconfig_2.0.3
## [95] gtable_0.3.6 timeDate_4052.112
## [97] blob_1.3.0 S7_0.2.2
## [99] impute_1.87.0 XVector_0.53.0
## [101] sys_3.4.3 htmltools_0.5.9
## [103] MALDIquant_1.22.3 clue_0.3-68
## [105] scales_1.4.0 png_0.1-9
## [107] gower_1.0.2 knitr_1.51
## [109] MetaboCoreUtils_1.21.1 reshape2_1.4.5
## [111] coda_0.19-4.1 nlme_3.1-169
## [113] curl_7.1.0 proxy_0.4-29
## [115] cachem_1.1.0 stringr_1.6.0
## [117] KernSmooth_2.23-26 BiocVersion_3.24.0
## [119] parallel_4.6.0 mzID_1.51.0
## [121] vsn_3.81.0 pillar_1.11.1
## [123] vctrs_0.7.3 pcaMethods_2.5.0
## [125] randomForest_4.7-1.2 dbplyr_2.5.2
## [127] xtable_1.8-8 evaluate_1.0.5
## [129] mvtnorm_1.3-7 cli_3.6.6
## [131] compiler_4.6.0 rlang_1.2.0
## [133] crayon_1.5.3 future.apply_1.20.2
## [135] labeling_0.4.3 LaplacesDemon_16.1.8
## [137] mclust_6.1.2 QFeatures_1.23.1
## [139] affy_1.91.0 plyr_1.8.9
## [141] fs_2.1.0 stringi_1.8.7
## [143] viridisLite_0.4.3 Biostrings_2.81.1
## [145] lazyeval_0.2.3 Matrix_1.7-5
## [147] ExperimentHub_3.3.0 hms_1.1.4
## [149] bit64_4.8.0 future_1.70.0
## [151] KEGGREST_1.53.0 statmod_1.5.1
## [153] AnnotationHub_4.1.0 SummarizedExperiment_1.43.0
## [155] kernlab_0.9-33 igraph_2.3.0
## [157] memoise_2.0.1 affyio_1.83.0
## [159] bslib_0.10.0 sampling_2.11
## [161] bit_4.6.0
in R, open it with
vignette("MSnbase-development") or read it online here↩︎
in R, open it with vignette("benchmarking")
or read it online here↩︎
Mascot Generic Format, see http://www.matrixscience.com/help/data_file_help.html#GEN↩︎
This part will be automatically updated when the object is modified with it’s ad hoc methods, as illustrated later.↩︎
The identification data can also be passed as dedicated
identification objects such as mzRident from the mzR package
or mzID from thr mzID
package, or as a data.frame - see
?addIdentifionData for details.↩︎
The code to generate the histograms has been contributed by Guangchuang Yu.↩︎