Gene and genome duplications are a source of raw genetic material for evolution (Ohno 2013). However, whole-genome duplications (WGD) and small-scale duplications (SSD) contribute to genome evolution in different manners. To help you explore the different contributions of WGD and SSD to evolution, we developed doubletrouble, a package that can be used to identify and classify duplicated genes from whole-genome protein sequences, calculate substitution rates per substitution site (i.e., \(K_a\) and \(K_s\)) for gene pairs, find peaks in \(K_s\) distributions, and classify gene pairs by age groups.
You can install doubletrouble from Bioconductor with the following code:
if(!requireNamespace("BiocManager", quietly = TRUE)) {
install.packages("BiocManager")
}
BiocManager::install("doubletrouble")
## Check that you have a valid Bioconductor installation
BiocManager::valid()
Then, you can load the package:
library(doubletrouble)
To identify and classify duplicated gene pairs, users need two types of input data:
Whole-genome protein sequences (a.k.a. “proteome”), with only one protein sequence per gene (i.e., translated sequence of the primary transcript). These are typically stored in .fasta files.
Gene annotation, with genomic coordinates of all features (i.e., genes, exons, etc). These are typically stored in .gff3/.gff/.gtf files.
(Optional) Coding sequences (CDS), with only one DNA sequence sequence per gene. These are only required for users who want to calculate substitution rates (i.e., \(K_a\), \(K_s\), and their ratio \(K_a/K_s\)), and they are typically stored in .fasta files.
In the Bioconductor ecosystem, sequences and ranges are stored in
standardized S4 classes named
XStringSet (AAStringSet for proteins, DNAStringSet for DNA) and GRanges,
respectively. This ensures seamless interoperability across packages, which
is important for both users and package developers.
Thus, doubletrouble expects
proteomes in lists of AAStringSet objects, and annotations in lists of
GRanges objects. Below you can find a summary of input data types, their
typical file formats, and Bioconductor class.
| Input data | File format | Bioconductor class | Requirement |
|---|---|---|---|
| Proteome | FASTA | AAStringSet |
Mandatory |
| Annotation | GFF3/GTF | GRanges |
Mandatory |
| CDS | FASTA | DNAStringSet |
Optional |
Names of list elements represent species identifiers
(e.g., name, abbreviations, taxonomy IDs, or anything you like), and must
be consistent across different lists, so correspondence can be made.
For instance, suppose you have an object named seqs with a list of
AAStringSet objects (proteomes for each species)
named Athaliana, Alyrata, and Bnapus. You also have an object
named annotation with a list of GRanges objects (gene annotation for
each species). In this example, list names in annotation must also be
Athaliana, Alyrata, and Bnapus (not necessarily in that order), so that
doubletrouble knows that element Athaliana
in seqs corresponds to element Athaliana in annotation. You can check
that with:
# Checking if names of lists match
setequal(names(seqs), names(annotation)) # should return TRUE
IMPORTANT: If you have protein sequences as FASTA files in a directory,
you can read them into a list of AAStringSet objects with the function
fasta2AAStringSetlist() from the Bioconductor package
syntenet. Likewise, you can get a GRangesList
object from GFF/GTF files with the function gff2GRangesList(), also
from syntenet.
In this vignette, we will use data (proteome, gene annotations, and CDS) from the yeast species Saccharomyces cerevisiae and Candida glabrata, since their genomes are relatively small (and, hence, great for demonstration purposes). Our goal here is to identify and classify duplicated genes in the S. cerevisiae genome. The C. glabrata genome will be used as an outgroup to identify transposed duplicates later in this vignette.
Data were obtained from Ensembl Fungi release 54 (Yates et al. 2022). While you can download these data manually from the Ensembl Fungi webpage (or through another repository such as NCBI RefSeq), here we will demonstrate how you can get data from Ensembl using the biomartr package.
species <- c("Saccharomyces cerevisiae", "Candida glabrata")
# Download data from Ensembl with {biomartr}
## Whole-genome protein sequences (.fa)
fasta_dir <- file.path(tempdir(), "proteomes")
fasta_files <- biomartr::getProteomeSet(
db = "ensembl", organisms = species, path = fasta_dir
)
## Gene annotation (.gff3)
gff_dir <- file.path(tempdir(), "annotation")
gff_files <- biomartr::getGFFSet(
db = "ensembl", organisms = species, path = gff_dir
)
## CDS (.fa)
cds_dir <- file.path(tempdir(), "CDS")
cds_files <- biomartr::getCDSSet(
db = "ensembl", organisms = species, path = cds_dir
)
# Import data to the R session
## Read .fa files with proteomes as a list of AAStringSet + clean names
seq <- syntenet::fasta2AAStringSetlist(fasta_dir)
names(seq) <- gsub("\\..*", "", names(seq))
## Read .gff3 files as a list of GRanges
annot <- syntenet::gff2GRangesList(gff_dir)
names(annot) <- gsub("\\..*", "", names(annot))
## Read .fa files with CDS as a list of DNAStringSet objects
cds <- lapply(cds_files, Biostrings::readDNAStringSet)
names(cds) <- gsub("\\..*", "", basename(cds_files))
# Process data
## Keep ranges for protein-coding genes only
yeast_annot <- lapply(annot, function(x) {
gene_ranges <- x[x$biotype == "protein_coding" & x$type == "gene"]
gene_ranges <- IRanges::subsetByOverlaps(x, gene_ranges)
return(gene_ranges)
})
## Keep only longest sequence for each protein-coding gene (no isoforms)
yeast_seq <- lapply(seq, function(x) {
# Keep only protein-coding genes
x <- x[grep("protein_coding", names(x))]
# Leave only gene IDs in sequence names
names(x) <- gsub(".*gene:| .*", "", names(x))
# If isoforms are present (same gene ID multiple times), keep the longest
x <- x[order(Biostrings::width(x), decreasing = TRUE)]
x <- x[!duplicated(names(x))]
return(x)
})
Note that processing might differ depending on the data source. For instance, Ensembl adds gene ‘biotypes’ (e.g., protein-coding, pseudogene, etc) in sequence names and in a field named biotype in annotation files. Other databases might add these information elsewhere.
To avoid problems building this vignette (due to no/slow/unstable internet connection), the code chunk above is not executed. Instead, we ran such code and saved data in the following objects:
yeast_seq: A list of AAStringSet objects with elements
named Scerevisiae and Cglabrata.
yeast_annot: A GRangesList object with elements
named Scerevisiae and Cglabrata.
Let’s take a look at them.
# Load example data
data(yeast_seq)
data(yeast_annot)
yeast_seq
#> $Scerevisiae
#> AAStringSet object of length 6600:
#> width seq names
#> [1] 4910 MSQDRILLDLDVVNQRLILFNS...SELPEMLSLILRQYFTDLASS YLR106C
#> [2] 4092 MCKNEARLANELIEFVAATVTG...NYERLQAKEVASSTEQLLQEM YKR054C
#> [3] 3744 MSLTEQIEQFASRFRDDDATLQ...IGSAVSPRNLARTDVNFMPWF YHR099W
#> [4] 3268 MVLFTRCEKARKEKLAAGYKPL...ETLRGSLLLAINEGHEGFGLA YDR457W
#> [5] 3144 MLESLAANLLNRLLGSYVENFD...SLYRNIAIAVREYNKYCEAIL YLL040C
#> ... ... ...
#> [6596] 25 MFSLSNSQYTCQDYISDHIWKTSSH YOR302W
#> [6597] 25 MRAKWRKKRTRRLKRKRRKVRARSK YDL133C-A
#> [6598] 24 MHSNNSRQILIPHQNENMFLTELY YDL247W-A
#> [6599] 24 MLVLYRKRFSGFRFYFLSIFKYII YBR191W-A
#> [6600] 16 MLSLIFYLRFPSYIRG YJR151W-A
#>
#> $Cglabrata
#> AAStringSet object of length 5293:
#> width seq names
#> [1] 4880 MSIQSADTVVFDLDKAFQRRDE...VELPEMLALILRQYFSDLASQ CAGL0M11616g
#> [2] 4336 MYCIIRLCLLLLYMVRFAAAIV...ITFLGIKKCIILLIIVVVSIA CAGL0I10147g
#> [3] 4041 MVQRNIELARYITTLLIGVCPK...NDIESKVLDDTKQLLNSIEYV CAGL0K08294g
#> [4] 3743 MASADQISEYAEKLKDDQQSLA...ISASVNPRNLAKTDISFMPWF CAGL0A01914g
#> [5] 3247 MVKLTRFEKLQKEKNAEYFKPF...DTLRGSLLIAINEGHEGFGLA CAGL0K06303g
#> ... ... ...
#> [5289] 43 MLGAPISRDTPRKTRSKTQFFQGPIVSLITEKCTYEWGNPSIN CAGL0M02541g
#> [5290] 39 MLPGGPIVVLILVGLAACIIVATIIYRKWQERQRALARF CAGL0M03305g
#> [5291] 39 MLPGGVILVFILVGLAACAIVAVIIYRKWQERQRSLQRF CAGL0L08008g
#> [5292] 37 MINEGQLQTLVIGFGLAMVVLVVVYHAVASTMAVKRD CAGL0C05461g
#> [5293] 34 MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA CAGL0C01919g
yeast_annot
#> GRangesList object of length 2:
#> $Scerevisiae
#> GRanges object with 27144 ranges and 9 metadata columns:
#> seqnames ranges strand | type phase
#> <Rle> <IRanges> <Rle> | <factor> <integer>
#> [1] I 1-230218 * | chromosome <NA>
#> [2] I 335-649 + | gene <NA>
#> [3] I 335-649 + | mRNA <NA>
#> [4] I 335-649 + | exon <NA>
#> [5] I 335-649 + | CDS 0
#> ... ... ... ... . ... ...
#> [27140] XVI 944603-947701 + | CDS 0
#> [27141] XVI 946856-947338 - | gene <NA>
#> [27142] XVI 946856-947338 - | mRNA <NA>
#> [27143] XVI 946856-947338 - | exon <NA>
#> [27144] XVI 946856-947338 - | CDS 0
#> ID Parent Name
#> <character> <CharacterList> <character>
#> [1] chromosome:I <NA>
#> [2] gene:YAL069W <NA>
#> [3] transcript:YAL069W_m.. gene:YAL069W <NA>
#> [4] <NA> transcript:YAL069W_m.. YAL069W_mRNA-E1
#> [5] CDS:YAL069W transcript:YAL069W_m.. <NA>
#> ... ... ... ...
#> [27140] CDS:YPR204W transcript:YPR204W_m.. <NA>
#> [27141] gene:YPR204C-A <NA>
#> [27142] transcript:YPR204C-A.. gene:YPR204C-A <NA>
#> [27143] <NA> transcript:YPR204C-A.. YPR204C-A_mRNA-E1
#> [27144] CDS:YPR204C-A transcript:YPR204C-A.. <NA>
#> gene_id transcript_id exon_id protein_id
#> <character> <character> <character> <character>
#> [1] <NA> <NA> <NA> <NA>
#> [2] YAL069W <NA> <NA> <NA>
#> [3] <NA> YAL069W_mRNA <NA> <NA>
#> [4] <NA> <NA> YAL069W_mRNA-E1 <NA>
#> [5] <NA> <NA> <NA> YAL069W
#> ... ... ... ... ...
#> [27140] <NA> <NA> <NA> YPR204W
#> [27141] YPR204C-A <NA> <NA> <NA>
#> [27142] <NA> YPR204C-A_mRNA <NA> <NA>
#> [27143] <NA> <NA> YPR204C-A_mRNA-E1 <NA>
#> [27144] <NA> <NA> <NA> YPR204C-A
#> -------
#> seqinfo: 31 sequences from an unspecified genome; no seqlengths
#>
#> $Cglabrata
#> GRanges object with 31671 ranges and 9 metadata columns:
#> seqnames ranges strand | type phase
#> <Rle> <IRanges> <Rle> | <factor> <integer>
#> [1] ChrA_C_glabrata_CBS138 1-491328 * | region <NA>
#> [2] ChrA_C_glabrata_CBS138 1608-2636 - | gene <NA>
#> [3] ChrA_C_glabrata_CBS138 1608-2636 - | mRNA <NA>
#> [4] ChrA_C_glabrata_CBS138 1608-2636 - | exon <NA>
#> [5] ChrA_C_glabrata_CBS138 1608-2636 - | CDS 0
#> ... ... ... ... . ... ...
#> [31667] mito_C_glabrata_CBS138 15384-16067 + | CDS 0
#> [31668] mito_C_glabrata_CBS138 16756-17565 + | gene <NA>
#> [31669] mito_C_glabrata_CBS138 16756-17565 + | mRNA <NA>
#> [31670] mito_C_glabrata_CBS138 16756-17565 + | exon <NA>
#> [31671] mito_C_glabrata_CBS138 16756-17565 + | CDS 0
#> ID Parent Name
#> <character> <CharacterList> <character>
#> [1] region:ChrA_C_glabra.. <NA>
#> [2] gene:CAGL0A00105g <NA>
#> [3] transcript:CAGL0A001.. gene:CAGL0A00105g <NA>
#> [4] <NA> transcript:CAGL0A001.. CAGL0A00105g-T-E1
#> [5] CDS:CAGL0A00105g-T-p1 transcript:CAGL0A001.. <NA>
#> ... ... ... ...
#> [31667] CDS:CaglfMp11-T-p1 transcript:CaglfMp11-T <NA>
#> [31668] gene:CaglfMp12 COX3
#> [31669] transcript:CaglfMp12-T gene:CaglfMp12 <NA>
#> [31670] <NA> transcript:CaglfMp12-T CaglfMp12-T-E1
#> [31671] CDS:CaglfMp12-T-p1 transcript:CaglfMp12-T <NA>
#> gene_id transcript_id exon_id protein_id
#> <character> <character> <character> <character>
#> [1] <NA> <NA> <NA> <NA>
#> [2] CAGL0A00105g <NA> <NA> <NA>
#> [3] <NA> CAGL0A00105g-T <NA> <NA>
#> [4] <NA> <NA> CAGL0A00105g-T-E1 <NA>
#> [5] <NA> <NA> <NA> CAGL0A00105g-T-p1
#> ... ... ... ... ...
#> [31667] <NA> <NA> <NA> CaglfMp11-T-p1
#> [31668] CaglfMp12 <NA> <NA> <NA>
#> [31669] <NA> CaglfMp12-T <NA> <NA>
#> [31670] <NA> <NA> CaglfMp12-T-E1 <NA>
#> [31671] <NA> <NA> <NA> CaglfMp12-T-p1
#> -------
#> seqinfo: 31 sequences from an unspecified genome; no seqlengths
First of all, we need to process the list of protein sequences and gene ranges
to detect synteny with syntenet. We will do that
using the function process_input() from
the syntenet package.
library(syntenet)
# Process input data
pdata <- process_input(yeast_seq, yeast_annot)
# Inspect the output
names(pdata)
#> [1] "seq" "annotation"
pdata$seq
#> $Scerevisiae
#> AAStringSet object of length 6600:
#> width seq names
#> [1] 4910 MSQDRILLDLDVVNQRLILFNS...SELPEMLSLILRQYFTDLASS Sce_YLR106C
#> [2] 4092 MCKNEARLANELIEFVAATVTG...NYERLQAKEVASSTEQLLQEM Sce_YKR054C
#> [3] 3744 MSLTEQIEQFASRFRDDDATLQ...IGSAVSPRNLARTDVNFMPWF Sce_YHR099W
#> [4] 3268 MVLFTRCEKARKEKLAAGYKPL...ETLRGSLLLAINEGHEGFGLA Sce_YDR457W
#> [5] 3144 MLESLAANLLNRLLGSYVENFD...SLYRNIAIAVREYNKYCEAIL Sce_YLL040C
#> ... ... ...
#> [6596] 25 MFSLSNSQYTCQDYISDHIWKTSSH Sce_YOR302W
#> [6597] 25 MRAKWRKKRTRRLKRKRRKVRARSK Sce_YDL133C-A
#> [6598] 24 MHSNNSRQILIPHQNENMFLTELY Sce_YDL247W-A
#> [6599] 24 MLVLYRKRFSGFRFYFLSIFKYII Sce_YBR191W-A
#> [6600] 16 MLSLIFYLRFPSYIRG Sce_YJR151W-A
#>
#> $Cglabrata
#> AAStringSet object of length 5293:
#> width seq names
#> [1] 4880 MSIQSADTVVFDLDKAFQRRDE...VELPEMLALILRQYFSDLASQ Cgl_CAGL0M11616g
#> [2] 4336 MYCIIRLCLLLLYMVRFAAAIV...ITFLGIKKCIILLIIVVVSIA Cgl_CAGL0I10147g
#> [3] 4041 MVQRNIELARYITTLLIGVCPK...NDIESKVLDDTKQLLNSIEYV Cgl_CAGL0K08294g
#> [4] 3743 MASADQISEYAEKLKDDQQSLA...ISASVNPRNLAKTDISFMPWF Cgl_CAGL0A01914g
#> [5] 3247 MVKLTRFEKLQKEKNAEYFKPF...DTLRGSLLIAINEGHEGFGLA Cgl_CAGL0K06303g
#> ... ... ...
#> [5289] 43 MLGAPISRDTPRKTRSKTQFFQGPIVSLITEKCTYEWGNPSIN Cgl_CAGL0M02541g
#> [5290] 39 MLPGGPIVVLILVGLAACIIVATIIYRKWQERQRALARF Cgl_CAGL0M03305g
#> [5291] 39 MLPGGVILVFILVGLAACAIVAVIIYRKWQERQRSLQRF Cgl_CAGL0L08008g
#> [5292] 37 MINEGQLQTLVIGFGLAMVVLVVVYHAVASTMAVKRD Cgl_CAGL0C05461g
#> [5293] 34 MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA Cgl_CAGL0C01919g
pdata$annotation
#> $Scerevisiae
#> GRanges object with 6600 ranges and 1 metadata column:
#> seqnames ranges strand | gene
#> <Rle> <IRanges> <Rle> | <character>
#> [1] Sce_I 335-649 + | Sce_YAL069W
#> [2] Sce_I 538-792 + | Sce_YAL068W-A
#> [3] Sce_I 1807-2169 - | Sce_YAL068C
#> [4] Sce_I 2480-2707 + | Sce_YAL067W-A
#> [5] Sce_I 7235-9016 - | Sce_YAL067C
#> ... ... ... ... . ...
#> [6596] Sce_XVI 939922-941136 + | Sce_YPR201W
#> [6597] Sce_XVI 943032-943896 + | Sce_YPR202W
#> [6598] Sce_XVI 943880-944188 + | Sce_YPR203W
#> [6599] Sce_XVI 944603-947701 + | Sce_YPR204W
#> [6600] Sce_XVI 946856-947338 - | Sce_YPR204C-A
#> -------
#> seqinfo: 17 sequences from an unspecified genome; no seqlengths
#>
#> $Cglabrata
#> GRanges object with 5293 ranges and 1 metadata column:
#> seqnames ranges strand | gene
#> <Rle> <IRanges> <Rle> | <character>
#> [1] Cgl_ChrA_C_glabrata_.. 1608-2636 - | Cgl_CAGL0A00105g
#> [2] Cgl_ChrA_C_glabrata_.. 2671-4809 - | Cgl_CAGL0A00116g
#> [3] Cgl_ChrA_C_glabrata_.. 11697-13042 + | Cgl_CAGL0A00132g
#> [4] Cgl_ChrA_C_glabrata_.. 14977-15886 + | Cgl_CAGL0A00154g
#> [5] Cgl_ChrA_C_glabrata_.. 17913-19017 - | Cgl_CAGL0A00165g
#> ... ... ... ... . ...
#> [5289] Cgl_mito_C_glabrata_.. 13275-13421 + | Cgl_CaglfMp08
#> [5290] Cgl_mito_C_glabrata_.. 13614-14396 + | Cgl_CaglfMp09
#> [5291] Cgl_mito_C_glabrata_.. 14631-14861 + | Cgl_CaglfMp10
#> [5292] Cgl_mito_C_glabrata_.. 15384-16067 + | Cgl_CaglfMp11
#> [5293] Cgl_mito_C_glabrata_.. 16756-17565 + | Cgl_CaglfMp12
#> -------
#> seqinfo: 14 sequences from an unspecified genome; no seqlengths
The processed data are represented as a list with the elements seq and
annotation, each containing the protein sequences and gene ranges for
each species, respectively.
Finally, we need to perform pairwise sequence similarity searches to
identify the whole set of paralogous gene pairs. We can do this
using the function run_diamond() from the syntenet
package 1 Note: you need to have DIAMOND installed in your machine to run
this function. If you don’t have it, you can use
the Herper package to install DIAMOND in a Conda
environment and run DIAMOND from this virtual environment., setting compare = "intraspecies" to perform only intraspecies
comparisons.
data(diamond_intra)
# Run DIAMOND in sensitive mode for S. cerevisiae only
if(diamond_is_installed()) {
diamond_intra <- run_diamond(
seq = pdata$seq["Scerevisiae"],
compare = "intraspecies",
outdir = file.path(tempdir(), "diamond_intra"),
... = "--sensitive"
)
}
# Inspect output
names(diamond_intra)
#> [1] "Scerevisiae_Scerevisiae"
head(diamond_intra$Scerevisiae_Scerevisiae)
#> query db perc_identity length mismatches gap_open qstart qend
#> 1 Sce_YLR106C Sce_YLR106C 100.0 4910 0 0 1 4910
#> 2 Sce_YLR106C Sce_YKR054C 22.4 420 254 19 804 1195
#> 3 Sce_YKR054C Sce_YKR054C 100.0 4092 0 0 1 4092
#> 4 Sce_YKR054C Sce_YLR106C 22.4 420 254 19 1823 2198
#> 5 Sce_YHR099W Sce_YHR099W 100.0 3744 0 0 1 3744
#> 6 Sce_YHR099W Sce_YJR066W 22.7 339 201 12 3351 3674
#> tstart tend evalue bitscore
#> 1 1 4910 0.00e+00 9095.0
#> 2 1823 2198 1.30e-06 53.1
#> 3 1 4092 0.00e+00 7940.0
#> 4 804 1195 1.09e-06 53.1
#> 5 1 3744 0.00e+00 7334.0
#> 6 2074 2366 6.46e-08 57.0
And voilà! Now that we have the DIAMOND output and the processed annotation, you can classify the duplicated genes.
To classify duplicated gene pairs based on their modes of duplication,
you will use the function classify_gene_pairs(). This function offers
four different classification schemes, depending on how much detail you
want. The classification schemes, along with the duplication modes
they identify and their required input, are summarized in the table below:
| Scheme | Duplication modes | Required input |
|---|---|---|
| binary | SD, SSD | blast_list, annotation |
| standard | SD, TD, PD, DD | blast_list, annotation |
| extended | SD, TD, PD, TRD, DD | blast_list, annotation, blast_inter |
| full | SD, TD, PD, rTRD, dTRD, DD | blast_list, annotation, blast_inter, intron_counts |
Legend: SD, segmental duplication. SSD, small-scale duplication. TD, tandem duplication. PD, proximal duplication. TRD, transposon-derived duplication. rTRD, retrotransposon-derived duplication. dTRD, DNA transposon-derived duplication. DD, dispersed duplication.
As shown in the table, the minimal input objects are:
syntenet::run_diamond(..., compare = 'intraspecies').GRangesList object)
as returned by syntenet::process_input().However, if you also want to identify transposon-derived duplicates (TRD) and further classify them as retrotransposon-derived duplicates (rTRD) or DNA transposon-derived duplicates (dTRD), you will need the following objects:
syntenet::run_diamond(..., compare = <comparison_data_frame>).get_intron_counts().Below, we demonstrate each classification scheme with examples.
The binary scheme classifies duplicates as derived from either
segmental duplications (SD) or small-scale duplications (SSD).
To identify segmental duplicates, the function classify_gene_pairs()
performs intragenome synteny detection scans
with syntenet and classifies any detected anchor
pairs as segmental duplicates. The remaining pairs are classified as
originating from small-scale duplications.
This scheme can be used by specifying scheme = "binary" in the
function classify_gene_pairs().
# Binary scheme
c_binary <- classify_gene_pairs(
annotation = pdata$annotation,
blast_list = diamond_intra,
scheme = "binary"
)
# Inspecting the output
names(c_binary)
#> [1] "Scerevisiae"
head(c_binary$Scerevisiae)
#> dup1 dup2 type
#> 9 Sce_YDR457W Sce_YER125W SSD
#> 10 Sce_YDR457W Sce_YJR036C SSD
#> 11 Sce_YDR457W Sce_YGL141W SSD
#> 12 Sce_YDR457W Sce_YKL010C SSD
#> 15 Sce_YBR140C Sce_YOL081W SSD
#> 21 Sce_YBL088C Sce_YBR136W SSD
# How many pairs are there for each duplication mode?
table(c_binary$Scerevisiae$type)
#>
#> SD SSD
#> 342 3246
The function returns a list of data frames, each containing the duplicated gene pairs and their modes of duplication for each species (here, because we have only one species, this is a list of length 1).
Gene pairs derived from small-scale duplications can be further classified as originating from tandem duplications (TD, genes are adjacent to each other), proximal duplications (PD, genes are separated by only a few genes), or dispersed duplications (DD, duplicates that do not fit in any of the previous categories).
This is the default classification scheme in classify_gene_pairs(),
and it can be specified by setting scheme = "standard".
# Standard scheme
c_standard <- classify_gene_pairs(
annotation = pdata$annotation,
blast_list = diamond_intra,
scheme = "standard"
)
# Inspecting the output
names(c_standard)
#> [1] "Scerevisiae"
head(c_standard$Scerevisiae)
#> dup1 dup2 type
#> 124 Sce_YGR032W Sce_YLR342W SD
#> 176 Sce_YOR396W Sce_YPL283C SD
#> 189 Sce_YJL225C Sce_YIL177C SD
#> 275 Sce_YNR031C Sce_YCR073C SD
#> 285 Sce_YOR326W Sce_YAL029C SD
#> 312 Sce_YJL222W Sce_YIL173W SD
# How many pairs are there for each duplication mode?
table(c_standard$Scerevisiae$type)
#>
#> SD TD PD DD
#> 342 42 80 3124
To find transposon-derived duplicates (TRD), the
function classify_gene_pairs() detects syntenic regions between a target
species and an outgroup species. Genes in the target species that are in
syntenic regions with the outgroup are treated as ancestral loci. Then,
if only one gene of the duplicate pair is an ancestral locus, this
duplicate pair is classified as originating from transposon-derived
duplications.
Since finding transposon-derived duplicates requires detecting syntenic regions
between a target species and an outgroup species, you will first need to
perform similarity searches with DIAMOND (Buchfink, Reuter, and Drost 2021),
BLAST (Altschul et al. 1997), or similar programs. This can be done with
syntenet::run_diamond(seq, compare = compare_df). For the parameter compare,
you will pass a 2-column data frame specifying the comparisons to be made. 2 Pro tip: If you want to identify and classify duplicated genes for
multiple species in batch, you must include the outgroup for each of them
in the comparisons data frame.
Importantly, for a more accurate detection of interspecies synteny, you need to
perform bidirectional similarity searches for each comparison. For instance,
if you want to use speciesA as target species and speciesB as outgroup,
you need to perform similarity searches in both directions:
speciesA_speciesB and speciesB_speciesA.
Here, we will identify duplicated gene pairs for Saccharomyces cerevisiae
using Candida glabrata as an outgroup. To create a data frame with the
bidirectional comparisons to be made, we will use the helper function make_bidirectional() from the syntenet package.
# Create a data frame of species and outgroups for `syntenet::run_diamond()`
spp_outgroup <- data.frame(
species = "Scerevisiae",
outgroup = "Cglabrata"
)
spp_outgroup
#> species outgroup
#> 1 Scerevisiae Cglabrata
# Expand the data frame to make bidirectional comparisons
comparisons <- syntenet::make_bidirectional(spp_outgroup)
comparisons
#> species outgroup
#> 1 Scerevisiae Cglabrata
#> 2 Cglabrata Scerevisiae
Now that we have a data frame with our desired comparisons, we can pass it
to syntenet::run_diamond().
data(diamond_inter) # load pre-computed output in case DIAMOND is not installed
# Run DIAMOND for the comparisons we specified
if(diamond_is_installed()) {
diamond_inter <- run_diamond(
seq = pdata$seq,
compare = comparisons,
outdir = file.path(tempdir(), "diamond_inter"),
... = "--sensitive"
)
}
names(diamond_inter)
#> [1] "Cglabrata_Scerevisiae" "Scerevisiae_Cglabrata"
head(diamond_inter$Scerevisiae_Cglabrata)
#> query db perc_identity length mismatches gap_open qstart
#> 1 Sce_YLR106C Cgl_CAGL0M11616g 52.3 4989 2183 50 2
#> 2 Sce_YLR106C Cgl_CAGL0K08294g 23.1 347 215 12 1064
#> 3 Sce_YKR054C Cgl_CAGL0K08294g 26.5 4114 2753 81 83
#> 4 Sce_YKR054C Cgl_CAGL0M11616g 22.7 419 254 17 1823
#> 5 Sce_YHR099W Cgl_CAGL0A01914g 70.2 3761 1087 17 1
#> 6 Sce_YDR457W Cgl_CAGL0K06303g 55.5 3318 1355 39 1
#> qend tstart tend evalue bitscore
#> 1 4909 5 4879 0.00e+00 4439.0
#> 2 1389 1770 2085 9.10e-07 53.5
#> 3 4089 87 4035 0.00e+00 1376.0
#> 4 2198 803 1194 7.59e-07 53.5
#> 5 3744 1 3743 0.00e+00 5200.0
#> 6 3268 1 3247 0.00e+00 3302.0
As you can see, for each species-outgroup pair, diamond_inter contains two
data frames: one named Scerevisiae_Cglabrata, and one named
Cglabrata_Scerevisiae. Before actually classifying gene pairs, we will
need to collapse these data frames so that we have
only one data frame per species-outgroup pair. This can be easily done
with the function collapse_bidirectional_hits() from
syntenet. As input, this function takes a
list of interspecies DIAMOND data frames, and a 2-column data frame indicating
the target species and the outgroup species (columns 1 and 2, respectively;
double-check the order of the columns!).
# For each species-outgroup pair, collapse bidirectional hits in one data frame
diamond_inter <- syntenet::collapse_bidirectional_hits(
diamond_inter, compare = spp_outgroup
)
names(diamond_inter)
#> [1] "Scerevisiae_Cglabrata"
Then, we can pass this interspecies DIAMOND output as an argument to
the parameter blast_inter of classify_gene_pairs().
# Extended scheme
c_extended <- classify_gene_pairs(
annotation = pdata$annotation,
blast_list = diamond_intra,
scheme = "extended",
blast_inter = diamond_inter
)
# Inspecting the output
names(c_extended)
#> [1] "Scerevisiae"
head(c_extended$Scerevisiae)
#> dup1 dup2 type
#> 124 Sce_YGR032W Sce_YLR342W SD
#> 176 Sce_YOR396W Sce_YPL283C SD
#> 189 Sce_YJL225C Sce_YIL177C SD
#> 275 Sce_YNR031C Sce_YCR073C SD
#> 285 Sce_YOR326W Sce_YAL029C SD
#> 312 Sce_YJL222W Sce_YIL173W SD
# How many pairs are there for each duplication mode?
table(c_extended$Scerevisiae$type)
#>
#> SD TD PD TRD DD
#> 342 42 80 1013 2111
In the example above, we used only one outgroup species (C. glabrata).
However, since results might change depending on the chosen outgroup,
you can also use multiple outgroups in the comparisons data frame, and then
run interspecies DIAMOND searches as above. For instance, suppose you want
to use speciesB, speciesC, and speciesD as outgroups to speciesA.
In this case, your data frame of comparisons (to be passed to the compare
argument of syntenet::run_diamond()) would look like the following:
# Example: multiple outgroups for the same species
spp_outgroup_many <- data.frame(
species = rep("speciesA", 3),
outgroup = c("speciesB", "speciesC", "speciesD")
)
comparisons_many <- syntenet::make_bidirectional(spp_outgroup_many)
comparisons_many
#> species outgroup
#> 1 speciesA speciesB
#> 2 speciesA speciesC
#> 3 speciesA speciesD
#> 4 speciesB speciesA
#> 5 speciesC speciesA
#> 6 speciesD speciesA
When multiple outgroups are present, classify_gene_pairs() will check if
gene pairs are classified as transposed (i.e., only one gene is an ancestral
locus) in each of the outgroup species, and then calculate the percentage of
outgroup species in which each pair is considered ‘transposed’. For instance,
you could have gene pair 1 as transposed based on 30% of the outgroup species,
gene pair 2 as transposed based on 100% of the outgroup species,
gene pair 3 based on 0% of the outgroup species, and so on. By default,
pairs are considered ‘transposed’ if they are classified as such
in >70% of the outgroups, but you can choose a different minimum percentage
cut-off using parameter outgroup_coverage.
Finally, the full scheme consists in classifying transposon-derived
duplicates (TRD) further as originating from retrotransposons (rTRD) or
DNA transposons (dTRD). To do that, the function classify_gene_pairs()
uses the number of introns per gene to find TRD pairs for which
one gene has at least 1 intron, and the other gene has no introns; if that
is the case, the pair is classified as originating from the activity
of retrotransposons (rTRD, i.e., the transposed gene without introns is
a processed transcript that was retrotransposed back to the genome). All the
other TRD pairs are classified as DNA transposon-derived duplicates (dTRD).
To classify duplicates using this scheme, you will first need to create a list
of data frames with the number of introns per gene for each species. This
can be done with the function get_intron_counts(), which takes a TxDb
object as input. TxDb objects store transcript annotations, and they
can be created with a family of functions
named makeTxDbFrom* from the txdbmaker
package (see ?get_intron_counts() for a summary of all functions).
Here, we will create a list of TxDb objects from a list of GRanges objects
using the function makeTxDbFromGRanges()
from txdbmaker. Importantly, to create
a TxDb from a GRanges, the GRanges object must contain genomic coordinates
for all features, including transcripts, exons, etc. Because of that, we
will use annotation from the example data set yeast_annot,
which was not processed with syntenet::process_input().
library(txdbmaker)
# Create a list of `TxDb` objects from a list of `GRanges` objects
txdb_list <- lapply(yeast_annot, txdbmaker::makeTxDbFromGRanges)
#> Warning in .makeTxDb_normarg_chrominfo(chrominfo): genome version information
#> is not available for this TxDb object
#> Warning in .makeTxDb_normarg_chrominfo(chrominfo): genome version information
#> is not available for this TxDb object
txdb_list
#> $Scerevisiae
#> TxDb object:
#> # Db type: TxDb
#> # Supporting package: GenomicFeatures
#> # Genome: NA
#> # Nb of transcripts: 6631
#> # Db created by: txdbmaker package from Bioconductor
#> # Creation time: 2026-04-28 18:01:32 -0400 (Tue, 28 Apr 2026)
#> # txdbmaker version at creation time: 1.8.0
#> # RSQLite version at creation time: 2.4.6
#> # DBSCHEMAVERSION: 1.2
#>
#> $Cglabrata
#> TxDb object:
#> # Db type: TxDb
#> # Supporting package: GenomicFeatures
#> # Genome: NA
#> # Nb of transcripts: 5389
#> # Db created by: txdbmaker package from Bioconductor
#> # Creation time: 2026-04-28 18:01:32 -0400 (Tue, 28 Apr 2026)
#> # txdbmaker version at creation time: 1.8.0
#> # RSQLite version at creation time: 2.4.6
#> # DBSCHEMAVERSION: 1.2
Once we have the TxDb objects, we can get intron counts per gene with
get_intron_counts().
# Get a list of data frames with intron counts per gene for each species
intron_counts <- lapply(txdb_list, get_intron_counts)
# Inspecting the list
names(intron_counts)
#> [1] "Scerevisiae" "Cglabrata"
head(intron_counts$Scerevisiae)
#> gene introns
#> 1 Q0045 7
#> 2 Q0105 5
#> 3 Q0070 4
#> 4 Q0065 3
#> 5 Q0120 3
#> 6 Q0060 2
Finally, we can use this list to classify duplicates using the full scheme as follows:
# Full scheme
c_full <- classify_gene_pairs(
annotation = pdata$annotation,
blast_list = diamond_intra,
scheme = "full",
blast_inter = diamond_inter,
intron_counts = intron_counts
)
# Inspecting the output
names(c_full)
#> [1] "Scerevisiae"
head(c_full$Scerevisiae)
#> dup1 dup2 type
#> 124 Sce_YGR032W Sce_YLR342W SD
#> 176 Sce_YOR396W Sce_YPL283C SD
#> 189 Sce_YJL225C Sce_YIL177C SD
#> 275 Sce_YNR031C Sce_YCR073C SD
#> 285 Sce_YOR326W Sce_YAL029C SD
#> 312 Sce_YJL222W Sce_YIL173W SD
# How many pairs are there for each duplication mode?
table(c_full$Scerevisiae$type)
#>
#> SD TD PD rTRD dTRD DD
#> 342 42 80 50 963 2111
If you look carefully at the output of classify_gene_pairs(), you will notice
that some genes appear in more than one duplicate pair, and these pairs can
have different duplication modes assigned. There’s nothing wrong with it.
Consider, for example, a gene that was originated by a segmental duplication
some 60 million years ago, and then it underwent a tandem duplication
5 million years ago. In the output of classify_gene_pairs(), you’d see
this gene in two pairs, one with SD in the type column, and one
with TD.
If you want to assign each gene to a unique mode of duplication, you can
use the function classify_genes(). This function assigns duplication modes
hierarchically using factor levels in column type as the priority order.
The priority orders for each classification scheme are:
The input for classify_genes() is the list of gene pairs returned by
classify_gene_pairs().
# Classify genes into unique modes of duplication
c_genes <- classify_genes(c_full)
# Inspecting the output
names(c_genes)
#> [1] "Scerevisiae"
head(c_genes$Scerevisiae)
#> gene type
#> 1 Sce_YGR032W SD
#> 2 Sce_YOR396W SD
#> 3 Sce_YJL225C SD
#> 4 Sce_YNR031C SD
#> 5 Sce_YOR326W SD
#> 6 Sce_YJL222W SD
# Number of genes per mode
table(c_genes$Scerevisiae$type)
#>
#> SD TD PD rTRD dTRD DD
#> 683 67 70 66 878 846
You can use the function pairs2kaks() to calculate rates of nonsynonymous
substitutions per nonsynonymous site (\(K_a\)), synonymouys substitutions per
synonymous site (\(K_s\)), and their ratios (\(K_a/K_s\)). These rates are calculated
using the Bioconductor package MSA2dist, which
implements all codon models in KaKs_Calculator 2.0 (Wang et al. 2010).
For the purpose of demonstration, we will only calculate \(K_a\), \(K_s\),
and \(K_a/K_s\) for 5 TD-derived gene pairs. The CDS for TD-derived
genes were obtained from Ensembl Fungi (Yates et al. 2022), and
they are stored in cds_scerevisiae.
data(cds_scerevisiae)
head(cds_scerevisiae)
#> DNAStringSet object of length 6:
#> width seq names
#> [1] 3486 ATGGTTAATATAAGCATCGTAGC...TTGTCGCTTTATTACTGCTATAG YJR151C
#> [2] 3276 ATGGGCGAAGGAACTACTAAGGA...TTAATATTGGTATTAAACAATGA YDR040C
#> [3] 3276 ATGAGCGAGGGAACTGTCAAAGA...TTAATATCAGTGTCAAGCATTAA YDR038C
#> [4] 3276 ATGAGCGAGGGAACTGTCAAAGA...TTAATATTGGTATTAAACAATGA YDR039C
#> [5] 2925 ATGAACAGTATGGCCGATACCGA...CCATTACAACATTTCAAACATAA YAR019C
#> [6] 2646 ATGCTGGAGTTTCCAATATCAGT...TAGCTGTTCTGTTCGCCTTCTAG YJL078C
# Store DNAStringSet object in a list
cds_list <- list(Scerevisiae = cds_scerevisiae)
# Keep only top five TD-derived gene pairs for demonstration purposes
td_pairs <- c_full$Scerevisiae[c_full$Scerevisiae$type == "TD", ]
gene_pairs <- list(Scerevisiae = td_pairs[seq(1, 5, by = 1), ])
# Calculate Ka, Ks, and Ka/Ks
kaks <- pairs2kaks(gene_pairs, cds_list)
# Inspect the output
head(kaks)
#> $Scerevisiae
#> dup1 dup2 Ka Ks Ka_Ks type
#> 1 Q0055 Q0060 NaN NaN NaN TD
#> 2 Q0065 Q0060 0.420823 3.470190 0.1212680 TD
#> 3 Q0070 Q0045 0.167734 0.411453 0.4076630 TD
#> 4 Q0070 Q0065 0.258771 0.632833 0.4089090 TD
#> 5 Q0055 Q0050 0.340984 6.018550 0.0566555 TD
Importantly, pairs2kaks() expects all genes in the gene pairs to be present
in the CDS, with matching names. Species abbreviations in gene pairs (added
by syntenet) are automatically removed, so you should
not add them to the sequence names of your CDS.
Peaks in \(K_s\) distributions typically indicate whole-genome duplication (WGD)
events, and they can be identified by fitting Gaussian mixture models (GMMs) to
\(K_s\) distributions. In doubletrouble, this can be
performed with the function find_ks_peaks().
However, because of saturation at higher \(K_s\) values, only recent WGD
events can be reliably identified from \(K_s\)
distributions (Vanneste, Van de Peer, and Maere 2013). Recent WGD events are commonly found
in plant species, such as maize, soybean, apple, etc.
Although the genomes of yeast species have signatures of WGD,
these events are ancient, so it is very hard to find evidence for them
using \(K_s\) distributions. 3 Tip: You might be asking yourself: “How does one identify ancient
WGD, then?”. A common approach is to look for syntenic blocks (i.e.,
regions with conserved gene content and order) within genomes. This is what
classify_gene_pairs() does under the hood to find SD-derived gene pairs.
To demonstrate how you can find peaks in \(K_s\) distributions
with find_ks_peaks(), we will use a data frame containing \(K_s\) values for
duplicate pairs in the soybean (Glycine max) genome, which has undergone
2 WGDs events ~13 and ~58 million years ago (Schmutz et al. 2010).
Then, we will visualize \(K_s\) distributions with peaks using the function
plot_ks_peaks().
First of all, let’s look at the data and have a quick look at the distribution
with the function plot_ks_distro() (more details on this function in the
data visualization section).
# Load data and inspect it
data(gmax_ks)
head(gmax_ks)
#> dup1 dup2 Ks type
#> 1 GLYMA_07G035600 GLYMA_16G004800 0.1670 SD
#> 2 GLYMA_18G275200 GLYMA_08G252600 0.1070 SD
#> 3 GLYMA_09G282200 GLYMA_20G003400 0.0822 SD
#> 4 GLYMA_01G166400 GLYMA_11G077000 0.0904 SD
#> 5 GLYMA_07G252100 GLYMA_17G022300 0.1400 SD
#> 6 GLYMA_05G133100 GLYMA_08G087600 0.0883 SD
# Plot distribution
plot_ks_distro(gmax_ks)
By visual inspection, we can see 2 or 3 peaks. Based on our prior knowledge, we know that 2 WGD events have occurred in the ancestral of the Glycine genus and in the ancestral of all Fabaceae, which seem to correspond to the peaks we see at \(K_s\) values around 0.1 and 0.5, respectively. There could be a third, flattened peak at around 1.6, which would represent the WGD shared by all eudicots. Let’s test which number of peaks has more support: 2 or 3.
# Find 2 and 3 peaks and test which one has more support
peaks <- find_ks_peaks(gmax_ks$Ks, npeaks = c(2, 3), verbose = TRUE)
#> Optimal number of peaks: 3
#> Bayesian Information Criterion (BIC):
#> E V
#> 2 -100166.92 -88545.51
#> 3 -90965.74 -75323.87
#>
#> Top 3 models based on the BIC criterion:
#> V,3 V,2 E,3
#> -75323.87 -88545.51 -90965.74
names(peaks)
#> [1] "mean" "sd" "lambda" "ks"
str(peaks)
#> List of 4
#> $ mean : Named num [1:3] 0.123 0.6 1.596
#> ..- attr(*, "names")= chr [1:3] "1" "2" "3"
#> $ sd : num [1:3] 0.0572 0.2869 0.2504
#> $ lambda: num [1:3] 0.284 0.44 0.276
#> $ ks : num [1:68085] 0.167 0.107 0.0822 0.0904 0.14 0.0883 0.107 0.756 0.737 0.0872 ...
# Visualize Ks distribution
plot_ks_peaks(peaks)
As we can see, the presence of 3 peaks is more supported (lowest BIC). The function returns a list with the mean, variance and amplitude of mixture components (i.e., peaks), as well as the \(K_s\) distribution itself.
Now, suppose you just want to get the first 2 peaks. You can do that by
explictly saying to find_ks_peaks() how many peaks there are.
# Find 2 peaks ignoring Ks values > 1
peaks <- find_ks_peaks(gmax_ks$Ks, npeaks = 2, max_ks = 1)
plot_ks_peaks(peaks)
Important consideration on GMMs and \(K_s\) distributions: Peaks identified with GMMs should not be blindly regarded as “the truth”. Using GMMs to find peaks in \(K_s\) distributions can lead to problems such as overfitting and overclustering (Tiley, Barker, and Burleigh 2018). Some general recommendations are:
Use your prior knowledge. If you know how many peaks there are (e.g.,
based on literature evidence), just tell the number to find_ks_peaks().
Likewise, if you are not sure about how many peaks there are, but you know
the maximum number of peaks is N, don’t test for the presence of >N peaks.
GMMs can incorrectly identify more peaks than the actual number.
Test the significance of each peak with SiZer (Significant ZERo crossings
of derivatives) maps (Chaudhuri and Marron 1999).
This can be done with the function SiZer() from
the R package feature.
As an example of a SiZer map, let’s use feature::SiZer() to assess
the significance of the 2 peaks we found previously.
# Get numeric vector of Ks values <= 1
ks <- gmax_ks$Ks[gmax_ks$Ks <= 1]
# Get SiZer map
feature::SiZer(ks)
The blue regions in the SiZer map indicate significantly increasing regions of the curve, which support the 2 peaks we found.
Finally, you can use the peaks you obtained before to classify gene pairs
by age group. Age groups are defined based on the \(K_s\) peak to which pairs belong.
This is useful if you want to analyze duplicate pairs
from a specific WGD event, for instance. You can do this with
the function split_pairs_by_peak(). This function returns a list containing
the classified pairs in a data frame, and a ggplot object with the
age boundaries highlighted in the histogram of \(K_s\) values.
# Gene pairs without age-based classification
head(gmax_ks)
#> dup1 dup2 Ks type
#> 1 GLYMA_07G035600 GLYMA_16G004800 0.1670 SD
#> 2 GLYMA_18G275200 GLYMA_08G252600 0.1070 SD
#> 3 GLYMA_09G282200 GLYMA_20G003400 0.0822 SD
#> 4 GLYMA_01G166400 GLYMA_11G077000 0.0904 SD
#> 5 GLYMA_07G252100 GLYMA_17G022300 0.1400 SD
#> 6 GLYMA_05G133100 GLYMA_08G087600 0.0883 SD
# Classify gene pairs by age group
pairs_age_group <- split_pairs_by_peak(gmax_ks[, c(1,2,3)], peaks)
# Inspecting the output
names(pairs_age_group)
#> [1] "pairs" "plot"
# Take a look at the classified gene pairs
head(pairs_age_group$pairs)
#> dup1 dup2 ks peak
#> 1 GLYMA_07G035600 GLYMA_16G004800 0.1670 1
#> 2 GLYMA_18G275200 GLYMA_08G252600 0.1070 1
#> 3 GLYMA_09G282200 GLYMA_20G003400 0.0822 1
#> 4 GLYMA_01G166400 GLYMA_11G077000 0.0904 1
#> 5 GLYMA_07G252100 GLYMA_17G022300 0.1400 1
#> 6 GLYMA_05G133100 GLYMA_08G087600 0.0883 1
# Visualize Ks distro with age boundaries
pairs_age_group$plot
Age groups can also be used to identify SD gene pairs that likely originated from whole-genome duplications. The rationale here is that segmental duplicates with \(K_s\) values near \(K_s\) peaks (indicating WGD events) were likely created by such WGDs. In a similar logic, SD pairs with \(K_s\) values that are too distant from \(K_s\) peaks (e.g., >2 standard deviations away from the mean) were likely created by duplications of large genomic segments, but not duplications of the entire genome.
As an example, to find gene pairs in the soybean genome that likely originated from the WGD event shared by all legumes (at ~58 million years ago), you’d need to extract SD pairs in age group 2 using the following code:
# Get all pairs in age group 2
pairs_ag2 <- pairs_age_group$pairs[pairs_age_group$pairs$peak == 2, c(1,2)]
# Get all SD pairs
sd_pairs <- gmax_ks[gmax_ks$type == "SD", c(1,2)]
# Merge tables
pairs_wgd_legumes <- merge(pairs_ag2, sd_pairs)
head(pairs_wgd_legumes)
#> dup1 dup2
#> 1 GLYMA_01G001800 GLYMA_07G130700
#> 2 GLYMA_01G002100 GLYMA_05G221300
#> 3 GLYMA_01G002300 GLYMA_07G130100
#> 4 GLYMA_01G002600 GLYMA_07G129700
#> 5 GLYMA_01G003500 GLYMA_05G222800
#> 6 GLYMA_01G003500 GLYMA_08G029700
Last but not least, doubletrouble provides users
with graphical functions to produce publication-ready plots from the output
of classify_gene_pairs(), classify_genes(), and pairs2kaks().
Let’s take a look at them one by one.
To visualize the frequency of duplicated gene pairs or genes by duplication
type (as returned by classify_gene_pairs() and classify_genes(),
respectively), you will first need to create a data frame of counts with
duplicates2counts(). To demonstrate how this works, we will use an
example data set with duplicate pairs for 3 fungi species (and substitution
rates, which will be ignored by duplicates2counts()).
# Load data set with pre-computed duplicates for 3 fungi species
data(fungi_kaks)
names(fungi_kaks)
#> [1] "saccharomyces_cerevisiae" "candida_glabrata"
#> [3] "schizosaccharomyces_pombe"
head(fungi_kaks$saccharomyces_cerevisiae)
#> dup1 dup2 Ka Ks Ka_Ks type
#> 1 YGR032W YLR342W 0.058800 5.240000 0.0112 SD
#> 2 YOR396W YPL283C 0.004010 0.009920 0.4040 SD
#> 3 YJL225C YIL177C 0.000253 0.000758 0.3340 SD
#> 4 YNR031C YCR073C 0.364000 5.070000 0.0718 SD
#> 5 YOR326W YAL029C 0.396000 5.150000 0.0769 SD
#> 6 YJL222W YIL173W 0.000276 NA NA SD
# Get a data frame of counts per mode in all species
counts_table <- duplicates2counts(fungi_kaks |> classify_genes())
counts_table
#> type n species
#> 1 SD 683 saccharomyces_cerevisiae
#> 2 TD 67 saccharomyces_cerevisiae
#> 3 PD 70 saccharomyces_cerevisiae
#> 4 rTRD 0 saccharomyces_cerevisiae
#> 5 dTRD 0 saccharomyces_cerevisiae
#> 6 DD 1790 saccharomyces_cerevisiae
#> 7 SD 14 candida_glabrata
#> 8 TD 104 candida_glabrata
#> 9 PD 42 candida_glabrata
#> 10 rTRD 0 candida_glabrata
#> 11 dTRD 0 candida_glabrata
#> 12 DD 1907 candida_glabrata
#> 13 SD 53 schizosaccharomyces_pombe
#> 14 TD 38 schizosaccharomyces_pombe
#> 15 PD 48 schizosaccharomyces_pombe
#> 16 rTRD 0 schizosaccharomyces_pombe
#> 17 dTRD 0 schizosaccharomyces_pombe
#> 18 DD 1853 schizosaccharomyces_pombe
Now, let’s visualize the frequency of duplicate gene pairs by duplication
type with the function plot_duplicate_freqs(). You can visualize frequencies
in three different ways, as demonstrated below.
# A) Facets
p1 <- plot_duplicate_freqs(counts_table)
# B) Stacked barplot, absolute frequencies
p2 <- plot_duplicate_freqs(counts_table, plot_type = "stack")
# C) Stacked barplot, relative frequencies
p3 <- plot_duplicate_freqs(counts_table, plot_type = "stack_percent")
# Combine plots, one per row
patchwork::wrap_plots(p1, p2, p3, nrow = 3) +
patchwork::plot_annotation(tag_levels = "A")
If you want to visually the frequency of duplicated genes (not gene pairs),
you’d first need to classify genes into unique modes of duplication
with classify_genes(), and then repeat the code above. For example:
# Frequency of duplicated genes by mode
classify_genes(fungi_kaks) |> # classify genes into unique duplication types
duplicates2counts() |> # get a data frame of counts (long format)
plot_duplicate_freqs() # plot frequencies
As briefly demonstrated before, to plot a \(K_s\) distribution for the
whole paranome, you will use the function plot_ks_distro().
ks_df <- fungi_kaks$saccharomyces_cerevisiae
# A) Histogram, whole paranome
p1 <- plot_ks_distro(ks_df, plot_type = "histogram")
# B) Density, whole paranome
p2 <- plot_ks_distro(ks_df, plot_type = "density")
# C) Histogram with density lines, whole paranome
p3 <- plot_ks_distro(ks_df, plot_type = "density_histogram")
# Combine plots side by side
patchwork::wrap_plots(p1, p2, p3, nrow = 1) +
patchwork::plot_annotation(tag_levels = "A")
However, visualizing the distribution for the whole paranome can mask patterns
that only happen for duplicates originating from particular duplication types.
For instance, when looking for evidence of WGD events,
visualizing the \(K_s\) distribution for SD-derived pairs only can reveal
whether syntenic genes cluster together, suggesting the presence of WGD history.
To visualize the distribution by duplication type, use bytype = TRUE in
plot_ks_distro().
# A) Duplicates by type, histogram
p1 <- plot_ks_distro(ks_df, bytype = TRUE, plot_type = "histogram")
# B) Duplicates by type, violin
p2 <- plot_ks_distro(ks_df, bytype = TRUE, plot_type = "violin")
# Combine plots side by side
patchwork::wrap_plots(p1, p2) +
patchwork::plot_annotation(tag_levels = "A")
The function plot_rates_by_species() can be used to show distributions of
substitution rates (\(K_s\), \(K_a\), or their ratio \(K_a/K_s\)) by species.
You can choose which rate you want to visualize, and whether or not to
group gene pairs by duplication mode, as demonstrated below.
# A) Ks for each species
p1 <- plot_rates_by_species(fungi_kaks)
# B) Ka/Ks by duplication type for each species
p2 <- plot_rates_by_species(fungi_kaks, rate_column = "Ka_Ks", bytype = TRUE)
# Combine plots - one per row
patchwork::wrap_plots(p1, p2, nrow = 2) +
patchwork::plot_annotation(tag_levels = "A")
This document was created under the following conditions:
sessioninfo::session_info()
#> ─ Session info ───────────────────────────────────────────────────────────────
#> setting value
#> version R version 4.6.0 Patched (2026-04-24 r89963)
#> os macOS Tahoe 26.3.1
#> system aarch64, darwin23
#> ui X11
#> language (EN)
#> collate C
#> ctype en_US.UTF-8
#> tz America/New_York
#> date 2026-04-28
#> pandoc 3.1.12.3 @ /opt/homebrew/bin/ (via rmarkdown)
#> quarto 1.7.32 @ /usr/local/bin/quarto
#>
#> ─ Packages ───────────────────────────────────────────────────────────────────
#> package * version date (UTC) lib source
#> abind 1.4-8 2024-09-12 [2] CRAN (R 4.6.0)
#> ade4 1.7-24 2026-03-21 [2] CRAN (R 4.6.0)
#> AnnotationDbi * 1.74.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> ape 5.8-1 2024-12-16 [2] CRAN (R 4.6.0)
#> Biobase * 2.72.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> BiocFileCache 3.2.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> BiocGenerics * 0.58.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> BiocIO 1.22.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> BiocManager 1.30.27 2025-11-14 [2] CRAN (R 4.6.0)
#> BiocParallel 1.46.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> BiocStyle * 2.40.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> biomaRt 2.68.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> Biostrings 2.80.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> bit 4.6.0 2025-03-06 [2] CRAN (R 4.6.0)
#> bit64 4.8.0 2026-04-21 [2] CRAN (R 4.6.0)
#> bitops 1.0-9 2024-10-03 [2] CRAN (R 4.6.0)
#> blob 1.3.0 2026-01-14 [2] CRAN (R 4.6.0)
#> bookdown 0.46 2025-12-05 [2] CRAN (R 4.6.0)
#> bslib 0.10.0 2026-01-26 [2] CRAN (R 4.6.0)
#> cachem 1.1.0 2024-05-16 [2] CRAN (R 4.6.0)
#> cigarillo 1.2.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> cli 3.6.6 2026-04-09 [2] CRAN (R 4.6.0)
#> coda 0.19-4.1 2024-01-31 [2] CRAN (R 4.6.0)
#> codetools 0.2-20 2024-03-31 [2] CRAN (R 4.6.0)
#> crayon 1.5.3 2024-06-20 [2] CRAN (R 4.6.0)
#> curl 7.1.0 2026-04-22 [2] CRAN (R 4.6.0)
#> DBI 1.3.0 2026-02-25 [2] CRAN (R 4.6.0)
#> dbplyr 2.5.2 2026-02-13 [2] CRAN (R 4.6.0)
#> DelayedArray 0.38.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> dichromat 2.0-0.1 2022-05-02 [2] CRAN (R 4.6.0)
#> digest 0.6.39 2025-11-19 [2] CRAN (R 4.6.0)
#> doParallel 1.0.17 2022-02-07 [2] CRAN (R 4.6.0)
#> doubletrouble * 1.12.0 2026-04-28 [1] Bioconductor 3.23 (R 4.6.0)
#> dplyr 1.2.1 2026-04-03 [2] CRAN (R 4.6.0)
#> evaluate 1.0.5 2025-08-27 [2] CRAN (R 4.6.0)
#> farver 2.1.2 2024-05-13 [2] CRAN (R 4.6.0)
#> fastmap 1.2.0 2024-05-15 [2] CRAN (R 4.6.0)
#> feature 1.2.15 2021-02-10 [2] CRAN (R 4.6.0)
#> filelock 1.0.3 2023-12-11 [2] CRAN (R 4.6.0)
#> foreach 1.5.2 2022-02-02 [2] CRAN (R 4.6.0)
#> generics * 0.1.4 2025-05-09 [2] CRAN (R 4.6.0)
#> GenomeInfoDb 1.48.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> GenomicAlignments 1.48.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> GenomicFeatures * 1.64.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> GenomicRanges * 1.64.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> ggnetwork 0.5.14 2025-09-10 [2] CRAN (R 4.6.0)
#> ggplot2 4.0.3 2026-04-22 [2] CRAN (R 4.6.0)
#> glue 1.8.1 2026-04-17 [2] CRAN (R 4.6.0)
#> gtable 0.3.6 2024-10-25 [2] CRAN (R 4.6.0)
#> hms 1.1.4 2025-10-17 [2] CRAN (R 4.6.0)
#> htmltools 0.5.9 2025-12-04 [2] CRAN (R 4.6.0)
#> httr 1.4.8 2026-02-13 [2] CRAN (R 4.6.0)
#> httr2 1.2.2 2025-12-08 [2] CRAN (R 4.6.0)
#> igraph 2.3.0 2026-04-21 [2] CRAN (R 4.6.0)
#> intergraph 2.0-4 2024-02-01 [2] CRAN (R 4.6.0)
#> IRanges * 2.46.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> iterators 1.0.14 2022-02-05 [2] CRAN (R 4.6.0)
#> jquerylib 0.1.4 2021-04-26 [2] CRAN (R 4.6.0)
#> jsonlite 2.0.0 2025-03-27 [2] CRAN (R 4.6.0)
#> KEGGREST 1.52.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> KernSmooth 2.23-26 2025-01-01 [2] CRAN (R 4.6.0)
#> knitr 1.51 2025-12-20 [2] CRAN (R 4.6.0)
#> ks 1.15.1 2025-05-04 [2] CRAN (R 4.6.0)
#> labeling 0.4.3 2023-08-29 [2] CRAN (R 4.6.0)
#> lattice 0.22-9 2026-02-09 [2] CRAN (R 4.6.0)
#> lifecycle 1.0.5 2026-01-08 [2] CRAN (R 4.6.0)
#> magrittr 2.0.5 2026-04-04 [2] CRAN (R 4.6.0)
#> MASS 7.3-65 2025-02-28 [2] CRAN (R 4.6.0)
#> Matrix 1.7-5 2026-03-21 [2] CRAN (R 4.6.0)
#> MatrixGenerics 1.24.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> matrixStats 1.5.0 2025-01-07 [2] CRAN (R 4.6.0)
#> mclust 6.1.2 2025-10-31 [2] CRAN (R 4.6.0)
#> memoise 2.0.1 2021-11-26 [2] CRAN (R 4.6.0)
#> MSA2dist 1.16.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> mvtnorm 1.3-7 2026-04-15 [2] CRAN (R 4.6.0)
#> network 1.20.0 2026-02-07 [2] CRAN (R 4.6.0)
#> nlme 3.1-169 2026-03-27 [2] CRAN (R 4.6.0)
#> otel 0.2.0 2025-08-29 [2] CRAN (R 4.6.0)
#> patchwork 1.3.2 2025-08-25 [2] CRAN (R 4.6.0)
#> pheatmap 1.0.13 2025-06-05 [2] CRAN (R 4.6.0)
#> pillar 1.11.1 2025-09-17 [2] CRAN (R 4.6.0)
#> pkgconfig 2.0.3 2019-09-22 [2] CRAN (R 4.6.0)
#> png 0.1-9 2026-03-15 [2] CRAN (R 4.6.0)
#> pracma 2.4.6 2025-10-22 [2] CRAN (R 4.6.0)
#> prettyunits 1.2.0 2023-09-24 [2] CRAN (R 4.6.0)
#> progress 1.2.3 2023-12-06 [2] CRAN (R 4.6.0)
#> purrr 1.2.2 2026-04-10 [2] CRAN (R 4.6.0)
#> pwalign 1.8.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> R6 2.6.1 2025-02-15 [2] CRAN (R 4.6.0)
#> rappdirs 0.3.4 2026-01-17 [2] CRAN (R 4.6.0)
#> RColorBrewer 1.1-3 2022-04-03 [2] CRAN (R 4.6.0)
#> Rcpp 1.1.1-1.1 2026-04-24 [2] CRAN (R 4.6.0)
#> RCurl 1.98-1.18 2026-03-21 [2] CRAN (R 4.6.0)
#> restfulr 0.0.16 2025-06-27 [2] CRAN (R 4.6.0)
#> rjson 0.2.23 2024-09-16 [2] CRAN (R 4.6.0)
#> rlang 1.2.0 2026-04-06 [2] CRAN (R 4.6.0)
#> rmarkdown 2.31 2026-03-26 [2] CRAN (R 4.6.0)
#> Rsamtools 2.28.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> RSQLite 2.4.6 2026-02-06 [2] CRAN (R 4.6.0)
#> rtracklayer 1.72.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> S4Arrays 1.12.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> S4Vectors * 0.50.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> S7 0.2.2 2026-04-22 [2] CRAN (R 4.6.0)
#> sass 0.4.10 2025-04-11 [2] CRAN (R 4.6.0)
#> scales 1.4.0 2025-04-24 [2] CRAN (R 4.6.0)
#> Seqinfo * 1.2.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> seqinr 4.2-44 2026-04-28 [2] CRAN (R 4.6.0)
#> sessioninfo 1.2.3 2025-02-05 [2] CRAN (R 4.6.0)
#> sna 2.8 2024-09-08 [2] CRAN (R 4.6.0)
#> SparseArray 1.12.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> statnet.common 4.13.0 2025-12-16 [2] CRAN (R 4.6.0)
#> stringi 1.8.7 2025-03-27 [2] CRAN (R 4.6.0)
#> stringr 1.6.0 2025-11-04 [2] CRAN (R 4.6.0)
#> SummarizedExperiment 1.42.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> syntenet * 1.14.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> tibble 3.3.1 2026-01-11 [2] CRAN (R 4.6.0)
#> tidyr 1.3.2 2025-12-19 [2] CRAN (R 4.6.0)
#> tidyselect 1.2.1 2024-03-11 [2] CRAN (R 4.6.0)
#> txdbmaker * 1.8.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> UCSC.utils 1.8.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> vctrs 0.7.3 2026-04-11 [2] CRAN (R 4.6.0)
#> withr 3.0.2 2024-10-28 [2] CRAN (R 4.6.0)
#> xfun 0.57 2026-03-20 [2] CRAN (R 4.6.0)
#> XML 3.99-0.23 2026-03-20 [2] CRAN (R 4.6.0)
#> XVector 0.52.0 2026-04-28 [2] Bioconductor 3.23 (R 4.6.0)
#> yaml 2.3.12 2025-12-10 [2] CRAN (R 4.6.0)
#>
#> [1] /private/var/folders/r0/l4fjk6cj5xj0j3brt4bplpl40000gt/T/RtmpfRmvxc/Rinst243b6e7ab2d1
#> [2] /Library/Frameworks/R.framework/Versions/4.6/Resources/library
#> * ── Packages attached to the search path.
#>
#> ──────────────────────────────────────────────────────────────────────────────